KEGG   Thermus thermophilus HB8: TTHA0473
Entry
TTHA0473          CDS       T00220                                 
Symbol
TTHA0473
Name
(GenBank) peptide ABC transporter, ATP-binding protein
  KO
K02032  peptide/nickel transport system ATP-binding protein
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TTHA0473 (TTHA0473)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ttj02000]
    TTHA0473 (TTHA0473)
Transporters [BR:ttj02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    TTHA0473 (TTHA0473)
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_16 AAA_22 SMC_N AAA_29 nSTAND3 MobB AAA_30 PRK AAA_5 AAA_33
Other DBs
NCBI-ProteinID: BAD70296
UniProt: Q5SL20
Position
1:442606..443589
AA seq 327 aa
MSTNGVLVEVRDLKKHFPIRGGVLSRVVASVKAVDGVSFAIRRGEVLGLVGESGSGKTTV
GRTLLRLIEPTGGRIFFDGQDITELPREKLRPFRRRMQIIFQDPFSSLNPRMTVGDIIAE
PLLIHGIGKTPKERTERVAELLKLVGLSPDHMRRYPHEFSGGQRQRIGIARALAVAPEFI
VADEPVSALDVSIQAQVVNLLQDLKEELGLTLLFIAHDLAVVEYISDRVAVMYLGKVMEL
APARELYRNPKHPYTEALLSAVPIPDPTVKRERIVLQGDIPSPINPPSGCVFRTRCRYAL
PECAQVVPELKEVAPGHYKACIRDDIL
NT seq 984 nt   +upstreamnt  +downstreamnt
gtgagcacgaacggcgtcctcgtggaggtgcgggacctgaagaagcacttccccatccgg
ggcggggtgctttcccgggtggtggcgagcgtgaaggcggtggacggggtgtccttcgcc
atccggaggggggaggtgcttgggcttgtgggggagtcggggagcgggaagaccacggtg
gggcgcacgctcctccggctgattgagcccacggggggtaggattttctttgacgggcag
gacatcacggagcttccccgggagaagctcaggcccttccggcgccggatgcagatcatc
ttccaggaccccttcagctcgttgaacccgcggatgaccgtgggggacattatcgccgag
cccctcctcatccacgggattgggaagacgccgaaggaacgcacggagagggtggcggag
cttttgaagctcgtggggctttccccggaccacatgcgccgctacccccacgagttctcc
ggggggcagaggcagcggatcgggatcgcccgcgccctggcggtggccccggagttcatc
gtggccgacgagccggtttccgccctggacgtgtccatccaggcgcaggtggtgaacctt
ctgcaggacctgaaggaggagcttgggctcaccctgctcttcatcgcccacgacctggcg
gtggtggagtacatctcggaccgggtggcggtgatgtacctggggaaggtgatggagctt
gcgcctgcccgggagctttaccgcaaccccaagcacccctacacggaggcgctgctttcg
gcggtgcccatccccgaccccacggtgaagcgggaaaggatcgtgctccagggggacatt
ccctcgcccatcaacccgccctcggggtgtgtcttccgcacgcggtgccgctacgccctg
cccgagtgcgcccaggtggtgcccgagctcaaggaggtcgccccgggccactacaaggcc
tgcatccgggacgacatcctctaa

DBGET integrated database retrieval system