KEGG   Thermus thermophilus HB8: TTHA0508Help
Entry
TTHA0508          CDS       T00220                                 

Definition
(RefSeq) MerR family transcriptional regulator
  KO
K13640  MerR family transcriptional regulator, heat shock protein HspR
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ttj03000]
    TTHA0508
Transcription factors [BR:ttj03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    TTHA0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR MerR_2 HTH_17 AP_endonuc_2 FAM184 Apolipoprotein MYO10_CC NYD-SP28
Motif
Other DBs
NCBI-GeneID: 3168252
NCBI-ProteinID: YP_143774
UniProt: Q5SKY5
Position
473046..473747
Genome map
AA seq 233 aa AA seqDB search
MDKVVDKDRPVYVISVAAELVEMHPQTLRLYERKGLIKPKRSSGKTRLYSERDIEKLREI
RRLTQELGVNLAGVEEIMRLRAELEALQARFEAEVARLKAEIGDRFQELERRALPPPGQT
EKPSPKDRPVYVISVAAELVEMHPQTLRLYERKGLIKPKRSSGKTRLYSERDIEKLREIR
RLTQELGVNLAGVEEIMRLRAELEALQARFEAEVARLKLLLLEKEKEEALGGG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggacaaggaccgccccgtgtacgtgatctcggtggcggcggagctt
gtggagatgcacccgcagacgcttcggctttacgagcggaagggtttgatcaagccgaag
cggtccagtgggaagacgcggctttactcggagcgggacattgagaagctccgggagatc
cgccgcctgacgcaggagcttggggtgaacctggcgggggtggaggagatcatgcggctt
cgggcggagctcgaggccctgcaggcccgctttgaggccgaggtggccaggctcaaggcg
gagatcggggaccgcttccaggagctggagcggagggccctgcccccgcccgggcagacg
gagaagccctcccccaaggaccgccccgtgtacgtgatctcggtggcggcggagcttgtg
gagatgcacccgcagacgcttcggctttacgagcggaagggtttgatcaagccgaagcgg
tccagtgggaagacgcggctttactcggagcgggacattgagaagctccgggagatccgc
cgcctgacgcaggagcttggggtgaacctggcgggggtggaggagatcatgcggcttcgg
gcggagctcgaggccctgcaggcccgctttgaggccgaggtggccaggctcaagctcctc
ctcttggagaaggagaaggaggaggccttgggcgggggctga

DBGET integrated database retrieval system