KEGG   Thermus thermophilus HB8: TTHA0533Help
Entry
TTHA0533          CDS       T00220                                 

Definition
(RefSeq) ribosomal RNA small subunit methyltransferase
  KO
K00564  16S rRNA (guanine1207-N2)-methyltransferase [EC:2.1.1.172]
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ttj03009]
    TTHA0533
Enzymes [BR:ttj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.172  16S rRNA (guanine1207-N2)-methyltransferase
     TTHA0533
Ribosome biogenesis [BR:ttj03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    TTHA0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_25 Methyltransf_31 Methyltransf_11 Cons_hypoth95 PrmA Methyltransf_23 Methyltransf_12 RrnaAD TehB DUF43 Met_10 CMAS NNMT_PNMT_TEMT MetW Methyltransf_16 UPF0020 Methyltransf_PK N6_Mtase
Motif
Other DBs
NCBI-GeneID: 3169440
NCBI-ProteinID: YP_143799
UniProt: Q5SKW0
Structure
PDB: 

Position
complement(495541..496668)
Genome map
AA seq 375 aa AA seqDB search
MSLTREAYHRLTPLPHPGGRLFIKPGARGYRDPVHDLLQKTVEPFGERALDLNPGVGWGS
LPLEGRMAVERLETSRAAFRCLTASGLQARLALPWEAAAGAYDLVVLALPAGRGTAYVQA
SLVAAARALRMGGRLYLAGDKNKGFERYFKEARALLGYGVVVRREGPYRVALLEKEKEAP
PLPSLWRAFSARILGAEYTFHHLPGVFSAGKVDPASLLLLEALQERLGPEGVRGRQVLDL
GAGYGALTLPLARMGAEVVGVEDDLASVLSLQKGLEANALKAQALHSDVDEALTEEARFD
IIVTNPPFHVGGAVILDVAQAFVNVAAARLRPGGVFFLVSNPFLKYEPLLEEKFGAFQTL
KVAEYKVLFAEKRGR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgacgcgggaagcctaccaccgcctcaccccccttccccaccccgggggccgg
ctcttcatcaagcccggggcccgggggtaccgggacccggtccacgacctcctgcagaag
acggtggagcccttcggcgagcgggccctggacctgaaccccggggtgggctggggaagc
ctccccttggaggggaggatggcggtggagcggctggagacctcccgggccgccttccgc
tgcctcacggcgagcggcctccaggcccggctcgcccttccctgggaggcggcggcggga
gcatacgacctcgtggtcctggccctccccgccgggagagggacggcctatgtccaggcg
agcctcgtggccgcggcccgggccctccggatgggaggacggctctacctcgccggggac
aagaacaaggggtttgagcgctacttcaaggaggcccgggcccttctgggctacggcgtg
gtggtgcggcgggaggggccctaccgggtggccctcctggagaaggagaaggaggccccg
cccctcccctccctctggcgggccttttccgcccgcatcctgggggcggagtacaccttc
caccacctccccggggtcttctcggcggggaaggtggacccggcctccctgctcctcctc
gaggccctgcaggaacgcctggggcccgagggggtccgcggccggcaggtcctggacctg
ggggcgggctatggggccctgaccctgcccctcgcccggatgggggcggaggtggtgggg
gtggaggacgacctggcctccgtcctctccctgcaaaagggcctcgaggccaacgccctg
aaggcccaggccctccactccgacgtggacgaggccttgacagaagaggcccggtttgac
atcatagttacgaaccccccctttcacgtggggggtgcggtcattctggatgtggcccag
gcgttcgtgaacgtggcggcggcccggctcaggccgggtggcgtgtttttcctcgtgtcc
aacccgttcctgaagtacgagcctttgctggaggagaagttcggcgccttccagaccctc
aaggtggccgaatacaaggtcctgttcgcggaaaagcgagggaggtga

DBGET integrated database retrieval system