KEGG   Thermus thermophilus HB8: TTHA0547
Entry
TTHA0547          CDS       T00220                                 
Symbol
TTHA0547
Name
(GenBank) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: DUF3234
Other DBs
NCBI-ProteinID: BAD70370
UniProt: Q5SKU6
Structure
Position
1:510962..511273
AA seq 103 aa
MAPDLSGTWYVLEGDPGEHLVVEALGERLSGIWTSRELAEAFLAHHPHLGMRVSALESRA
LKEAYLRALGMLQVEAVMVDYRPGTHRAQVARVKDLLEEVRRA
NT seq 312 nt   +upstreamnt  +downstreamnt
gtggcgcctgacctttccgggacctggtacgttttggagggagacccgggggagcacctg
gtggtggaggctttgggggagaggctttccgggatctggacgagccgggagctggccgag
gccttcctggcccaccacccccacctggggatgcgggtgagcgccttggagagccgggcc
ctgaaggaggcctacctccgggcccttgggatgctccaggtggaggcggtcatggtggac
taccgccccgggacccaccgggcgcaggtggctagggtgaaggaccttctagaggaggtg
cggcgtgcgtag

DBGET integrated database retrieval system