KEGG   Thermus thermophilus HB8: TTHA0555
Entry
TTHA0555          CDS       T00220                                 
Symbol
TTHA0555
Name
(GenBank) conserved hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: G3P_acyltransf Shikimate_DH OCD_Mu_crystall SMG1_N
Other DBs
NCBI-ProteinID: BAD70378
UniProt: Q5SKT8
Position
1:515984..517645
AA seq 553 aa
MTALLLSLAYLVGALPLGYWLARRRGVDLRTASPYTLGLESALRRLGLGLLLLSFLLDFL
KGYLPLLLGRALGLDLAGLLALGVAVYLGHLYPLFFRDPWPLRAKGAGVLLGILSGLPLP
PALGLVPVALGLVLYALTGYASLAALGLPLGLLGATLFGGFGLAERLSALALFLLALWRY
KENLGRVLEGTEPKLGDPLPLPSEKQVVCAFLIHPLTVEDFWQSPRFRWLRPLVRLGLLK
QEWIERLAERFRPMKVGEVRGVRTADGREVLCHLISAPLLPHQIKAKPELAVRRAIQGAR
LAKELGATVVGLGAFWSVVGEKGKRVQEAVPGIEVTNGGAYTAGTVRAAIPKILAHFAQS
GKDLKGATAAVVGANGVVAFGIARQIAPLVGRLILVGRDLERLKRAAESLRKNLERKGEA
PEILATTEIAAIREADLVFTATSDPNPVIYPEHVKPGAWIYDEGVPPDVHPSVREVPGVR
VTPGGVVRLPGEARATLDLHFGAPDQVPACLAETMILAAEEAFDRKSLGGEVRAENVQFF
VERAEALGFRVVE
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgaccgcgcttctcctttccctcgcctacctcgtgggggcgttgcctttggggtactgg
cttgccaggcggcgcggggtggacctgcgcacggcaagcccttacaccctgggcctggaa
agcgccctcaggcgcctgggcctgggccttctcctcctctccttcctcctggacttcctc
aagggctacctgccccttcttttggggcgggctttggggttggacctcgccggcctcctc
gccctgggggtggcggtctacctgggccacctctaccccctcttcttccgggacccctgg
cccctaagggccaagggggcgggggtcctcctcgggatcctctccggccttcccctcccg
cccgccttaggcctcgtccccgtggccttaggcctcgtcctctacgccctcaccggctac
gcctccctggccgccttggggcttcccctggggcttttgggggcgacgcttttcgggggg
ttcggccttgcggaaaggctttccgccctcgccctcttcctcctcgccctctggcgctac
aaggagaacctggggcgggtcctcgagggcacggaacccaagctcggcgaccccctgccc
ctcccctcggagaaacaggtggtctgcgccttcctcatccaccccctcaccgtggaggac
ttctggcagagcccccgcttccgctggctcaggcccctggtgcgcctgggcctcctgaag
caggagtggatagagcgcctcgccgagcgcttccgccccatgaaggtgggggaggtgcgg
ggggtgcggacggcggacgggcgggaggtcctatgccacctgatctccgcccccctcctt
ccccaccagatcaaggccaagccggagctcgccgtgcggcgggccatccagggggcgcgg
ctcgccaaggagctcggggccacagtggtgggcctcggggccttctggagcgtggtgggg
gagaaggggaagagggtgcaggaggcggtgccgggcattgaggtgacgaacggcggcgcc
tacaccgcgggcaccgtccgcgcggccatccccaagatcctcgcccacttcgcccaaagc
ggcaaggacctgaagggggccacggcggccgtggtgggggcgaacggggtggtggccttc
ggcatcgcccgccagatcgcccccttggtggggcggctcatcctggtggggcgggacttg
gaaaggcttaaacgggcggcggaaagcctccggaagaacctggagcgcaagggggaggcc
cccgagatcctggccaccacggagatcgccgccatacgggaggccgacctggtcttcacc
gccaccagcgaccccaatccggtgatctaccccgagcacgtgaagcccggggcctggatc
tacgacgagggcgtcccccctgacgtccacccctccgtcagggaggtgccgggggttagg
gtcacccccgggggggtggtgcggcttcccggggaggcgagggccaccctggacctccac
ttcggcgcccccgaccaggtccccgcctgcctcgccgagaccatgatcctggcggcggag
gaggcctttgaccggaaaagcctcgggggggaggtccgggcggagaacgtccagttcttc
gtggagcgtgccgaggccttggggtttagggtggtggagtag

DBGET integrated database retrieval system