KEGG   Thermus thermophilus HB8: TTHA0557Help
Entry
TTHA0557          CDS       T00220                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ttj  Thermus thermophilus HB8
Brite
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TTHA0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 3169327
NCBI-ProteinID: YP_143823
UniProt: P61503
Structure
PDB: 

Position
complement(518335..518949)
Genome map
AA seq 204 aa AA seqDB search
MPYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLL
RHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEK
LTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIDVWEHAYYLKYQNR
RADYLQAIWNVLNWDVAEEFFKKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacccgttcaagcttcctgacctaggctacccctacgaggccctcgagccccac
attgacgccaagaccatggagatccaccaccagaagcaccacggggcctacgtgacgaac
ctcaacgccgccctggagaagtacccctacctccacggggtggaggtggaggtcctcctg
aggcacctcgccgcccttccccaggacatccagaccgccgtgcgcaacaacgggggcggg
cacctgaaccacagcctcttctggaggctcctcacccccgggggggccaaggagcccgtg
ggggagctgaagaaggccattgacgagcagttcgggggcttccaggccctcaaggagaag
ctcacccaggcggccatgggccggttcggctcgggctgggcctggctcgtgaaggacccc
ttcggcaagctccacgtcctctccacccccaaccaagacaaccccgtgatggagggcttc
acccccatcgtgggcattgacgtctgggagcacgcctactacctcaagtaccagaaccgc
cgggccgattacctccaggccatctggaacgtcctcaactgggacgtggccgaggagttc
ttcaagaaggcctga

DBGET integrated database retrieval system