KEGG   Thermus thermophilus HB8: TTHA0566
Entry
TTHA0566          CDS       T00220                                 
Symbol
TTHA0566
Name
(GenBank) GTP-binding protein HflX
  KO
K03665  GTPase
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ttj03009]
    TTHA0566 (TTHA0566)
Ribosome biogenesis [BR:ttj03009]
 Prokaryotic type
  GTPases
   TTHA0566 (TTHA0566)
SSDB
Motif
Pfam: GTP-bdg_M GTP-bdg_N MMR_HSR1 FeoB_N GTP_EFTU AAA_16 cobW AAA_22 DO-GTPase2 AAA_23 MMR_HSR1_Xtn Dynamin_N ABC_tran
Other DBs
NCBI-ProteinID: BAD70389
UniProt: Q5SKS7
Position
1:527167..528678
AA seq 503 aa
MGRPLSLVLDREGRVVRVAVGDAKDVPFPEEGWSERRLSGYRLLHTHLGPGGLSRPDLSV
LFLRRLDNLAALEVEADGRPGLLHLAFLSPPRALEEDWRVLPPKPFHQYLDLDLWGEVMA
LEEELSRQARVLEVRDGSGERALLVGVDTGEGPEAEAVLRELAELTRTAGGVPVRQILVF
RKSLDPRYLVGLGKLEELKSLAYHENASTLIFGVDLTPAQAREIERVTGLKVLDRTQLIL
DIFALHAKTPEAQAQVELAQLRYLLPRLVGKGKEMSRLGGGIGTRGPGETKLEVDRRRLQ
DRIAHLSRKLQDYALRRQEARQKRKRRGVPLVAVVGYTNAGKTTLLRALTRAGEEGEDKL
FATLRPLTRRGFLPGVGEVLFTDTVGFIRHMPEELLTAFRATLEEVREADVLVHVLDASE
EGALERHRVVRDLLLDLGVEAPVVLALNKADRAAPYDLYFLGERLGGVPVSALKGTGLKE
LKEALARALLDLGVRPQAWAQYT
NT seq 1512 nt   +upstreamnt  +downstreamnt
gtggggaggcccttgagcctcgtcctggaccgggaggggcgggtggtgcgggtggccgtg
ggggacgccaaggacgttcccttccccgaggaggggtggagcgagaggcggctttccggc
taccgcctcctccacacccacctgggccccggggggctttcccggcccgacctctccgtc
ctcttcctcaggcggctggacaacctggccgccttggaggtggaggcggacgggcgcccg
ggccttttgcacctcgccttcctctcgccgcccagggccctggaggaggactggcgggtc
ctgccgcccaagcccttccaccagtacctggacctggacctctggggcgaggtcatggcc
ctggaggaggagctttcccgccaggcccgggtcctcgaggtccgggacgggagcggggag
cgggccctcctggtgggggtggacacgggggagggcccggaggcggaggcggtcttgcgg
gagctcgccgagctgacccggaccgcggggggcgtgccggtgaggcagatcctggtcttc
cgcaagagcctggacccgcggtacctggtgggcctcggcaagctggaggagctcaagagc
ctggcctaccacgagaacgcctccaccctcatcttcggcgtggacctcaccccggcccag
gcccgggagattgaaagggtcacgggcctcaaggtcctggaccggacccagctcatcctg
gacatcttcgccctccacgccaagacccccgaggcccaggcccaggtggagctggcccag
ctccgttacctcctcccccggctcgtggggaaggggaaggagatgagccgcctcgggggc
gggatcgggacccggggccccggggagacgaagctggaggtggaccggcgccgcctccag
gaccggatcgcccacctctcccgcaagctccaggactacgccctccgccgccaggaggcg
aggcagaagcggaagcggcggggcgtgcccttggtggcggtggtgggctacaccaacgcc
ggcaagaccaccctcctccgcgccctgacccgcgccggggaggagggggaggacaagctc
ttcgccaccttgcgccccctcacccgcaggggcttcctccccggggtgggggaggtcctc
ttcaccgacaccgtgggcttcatccgccacatgccggaagagctcctcaccgccttccgg
gcgaccctggaggaggtgagggaggcggacgtcctggtccacgtcctggacgcctcggag
gagggggcgctggagcggcaccgggtggtgcgggacctgcttttggacctcggggtggag
gcccccgtggtcctcgccctcaacaaggcggaccgggcggccccctacgacctctacttc
ctgggggagcgcctggggggcgttcccgtgtccgccctcaaggggacggggcttaaggag
ctcaaggaggccctcgcccgggccctgctggaccttggggtccgtccccaggcctgggct
cagtacacgtga

DBGET integrated database retrieval system