KEGG   Thermus thermophilus HB8: TTHA0574
Entry
TTHA0574          CDS       T00220                                 
Symbol
TTHA0574
Name
(GenBank) probable DNA polymerase III epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03030  DNA replication
ttj03430  Mismatch repair
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TTHA0574 (TTHA0574)
   03430 Mismatch repair
    TTHA0574 (TTHA0574)
   03440 Homologous recombination
    TTHA0574 (TTHA0574)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttj03032]
    TTHA0574 (TTHA0574)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0574 (TTHA0574)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TTHA0574 (TTHA0574)
DNA replication proteins [BR:ttj03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     TTHA0574 (TTHA0574)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     TTHA0574 (TTHA0574)
SSDB
Motif
Pfam: RNase_T RNase_H_2 DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: BAD70397
UniProt: Q5SKR9
Position
1:541898..542641
AA seq 247 aa
MEAAFRYRMATRLARRLREAGRPLPLPALGEALGLRGPVERVVRPLLDGRFLLEEGVGLW
EWRYPFPLEGEAVVVLDLETTGLAPGLDEVIEVGLLRLEGGRRLPFQSLVRPSRPPSPFV
ERLTGIPREALEEAPSLEEVLEKAYPLLADATLVIHNAAFDLGFLRPALEGLGYRLENPV
VDSLRLARRGLPGLRRYGLDALSEVLELPRRTCHRALEDVERTLAVVHEVYYMLTSGRPR
TLWELGR
NT seq 744 nt   +upstreamnt  +downstreamnt
atggaggccgccttccgctaccgcatggccacccggctcgcccgcaggctcagggaggcc
gggcgcccccttcccctccctgccctgggggaggccttggggcttcgcggccccgtggag
cgggtggtgcggccccttctggacgggaggttcctcctggaggagggggtggggctttgg
gagtggcgctacccctttcccctggagggggaggcggtggtggtcctggacctggagacc
acggggcttgccccgggcctggacgaggtgattgaggtgggcctcctccgcctggagggg
gggaggcgcctccccttccagagcctcgtccgcccctcccgcccgccgagccccttcgtg
gagcgcctcaccggcatcccccgggaggccctggaggaggccccctccctggaggaggtt
ctggagaaggcctaccccctcctcgccgacgccaccttggtgatccacaacgccgccttt
gacctgggcttcctccgcccggccttggagggcctgggctaccgcctggaaaaccccgtg
gtggactccctgcgcttggccagacggggcttaccaggccttaggcgctacggcctggac
gccctctccgaggtcctggagcttccccgaaggacctgccaccgggccctcgaggacgtg
gagcgcaccctcgccgtggtgcacgaggtatactatatgcttacgtccggccgtccccgc
acgctttgggaactcgggaggtag

DBGET integrated database retrieval system