KEGG   Thermus thermophilus HB8: TTHA0657Help
Entry
TTHA0657          CDS       T00220                                 

Definition
(RefSeq) 16S rRNA (uracil(1498)-N(3))-methyltransferase
  KO
K09761  16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ttj03009]
    TTHA0657
Enzymes [BR:ttj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     TTHA0657
Ribosome biogenesis [BR:ttj03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    TTHA0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrans_RNA
Motif
Other DBs
NCBI-GeneID: 3169973
NCBI-ProteinID: YP_143923
UniProt: Q5SKI6
Structure
PDB: 

Position
623728..624414
Genome map
AA seq 228 aa AA seqDB search
MRPHRAFSPGLTGVLPLRETRHLVEVLRARVGDRFTVFDGEREALAEVVDLGPPLRYRVL
EERRPEREVGVEVVLYVALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEMGEGKLRR
LRAVALEAAKQSGRVVVPEVLPPIPLKAVPQVAQGLVAHVGATARVREVLDPEKPLALAV
GPEGGFAEEEVALLEARGFTPVSLGRRILRAETAALALLALCTAGEGR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccccaccgcgcctttagccccggcctcacgggggtcctccccttgcgggagacc
cggcacctggtggaggtcctgagggcccgggtgggggaccggttcaccgtctttgacggg
gagcgggaggccctggccgaggtggtggacctgggcccccccttgcgctaccgcgtcctg
gaggagcggaggcccgagagggaggtgggggtggaggtggtcctctacgtggccctcctc
aagggggacaagctcgccgaggtggtgcgcgccgccacggagcttggggccacccggatc
cagcccctcgtcacccgccactccgtccccaaggagatgggggaggggaagctcaggcgg
cttagagcggtggccctcgaggcggcgaagcagtcggggcgggtggtggtccccgaggtc
ctcccccccatccccctgaaggcggtcccccaggtggcccagggcctcgtggcccatgtg
ggggccaccgcccgggtgcgggaggtcctggacccggaaaagcccctcgccctcgccgtg
gggccggaaggggggttcgccgaggaggaggtggccctcttggaggcccggggcttcacc
cccgtgagcctggggcggcgcatcctccgggcggagaccgccgccctcgccctcctcgcc
ctctgcaccgccggggagggaaggtga

DBGET integrated database retrieval system