KEGG   Thermus thermophilus HB8: TTHA0693Help
Entry
TTHA0693          CDS       T00220                                 

Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00072  Synthesis and degradation of ketone bodies
ttj00650  Butanoate metabolism
ttj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TTHA0693
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    TTHA0693
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     TTHA0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind DUF1776 Polysacc_synt_2 NAD_binding_10 2-Hacid_dh_C 3HCDH_N 3Beta_HSD Eno-Rase_NADH_b
Motif
Other DBs
NCBI-GeneID: 3168634
NCBI-ProteinID: YP_143959
UniProt: Q5SKF0
Position
complement(655953..656708)
Genome map
AA seq 251 aa AA seqDB search
MGAFSGRTVLVTGAGSGIGLAIARAFAREGARVLVHDVRDASRLAEELSGVFLQADLADP
KEVEALGKEAAAMGVDVLVNNAGFQHIAPVEEFPLEVWQRMLQVMLTAPFQLTQALLPGM
KRRGWGRILNIASIHGLVASPFKSAYISAKHGLIGLTKTVALEAGPHGVTVNAIAPAYVR
TPLVEGQIQDQAKTLGIPPEEVAEKVFLAQAAIKRLIAPEEVAELALFLASEKASAITGA
VFPIDLGWTAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgttttcgggaaggacggtcctcgtcaccggcgcgggaagcggcatcggcctc
gccatcgccagggccttcgcccgggagggggcgagggtcttggtccacgacgtgcgggac
gcctcgaggctcgccgaggagctttccggggtcttcctccaggcggacctcgccgacccc
aaagaggtggaggccctgggcaaggaggcagcggccatgggcgtggacgtcctggtgaac
aacgccggcttccagcacatcgcccccgtggaggagttccccctggaggtctggcaacgg
atgctccaggtgatgctcaccgcccctttccagctcacccaagccctcctccccgggatg
aagcgaaggggctggggccggatcctgaacatcgccagcatccacggcctggtggcgagc
ccctttaagagcgcctacatctcggccaagcacggcctcatcggcctcacgaagacggtg
gccctcgaggccgggccccatggcgtcaccgtaaacgccatcgcccccgcctacgtccgc
acccccctggtggagggccagatccaggaccaggccaaaaccctggggatcccccccgag
gaggtggcggagaaggtcttcctggcccaggcggccatcaagcgcctcatagcgcccgag
gaggtggccgagctcgccctcttcctggcctcggagaaggccagcgccatcaccggggcc
gtcttccccatagacctgggctggacggcccgctag

DBGET integrated database retrieval system