KEGG   Thermus thermophilus HB8: TTHA0711Help
Entry
TTHA0711          CDS       T00220                                 

Gene name
aspS
Definition
(RefSeq) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TTHA0711 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ttj01007]
    TTHA0711 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ttj03016]
    TTHA0711 (aspS)
   03029 Mitochondrial biogenesis [BR:ttj03029]
    TTHA0711 (aspS)
Enzymes [BR:ttj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     TTHA0711 (aspS)
Amino acid related enzymes [BR:ttj01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   TTHA0711 (aspS)
Transfer RNA biogenesis [BR:ttj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TTHA0711 (aspS)
 Prokaryotic type
   Other AARSs
    TTHA0711 (aspS)
Mitochondrial biogenesis [BR:ttj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TTHA0711 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 3169335
NCBI-ProteinID: YP_143977
UniProt: Q5SKD2
Structure
PDB: 

Position
complement(674930..676672)
Genome map
AA seq 580 aa AA seqDB search
MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATA
ERVRPEWVVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWRGEEEK
EASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGAR
DFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDL
EMSFVEVEDVLELNERLMAHVFREALGVELPLPFPRLSYEEAMERYGSDKPDLRFGLELK
EVGPLFRQSGFRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEGGFS
GGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKREGFRF
LWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGG
SIRIHDPRLQARVFRLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSP
SIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcacccactacgccggaagcctgagggaaacccacgtgggcgaggaggtggtc
ctcgagggctgggtcaaccgccgccgcgacctcggcggcctcatcttcctggacctcagg
gaccgggagggcctggtccagctcgtggcccaccccgctagccccgcctacgccaccgcc
gagcgggtgcgccccgagtgggtggtgcgggccaaaggcctcgtgcgcctccgccccgag
cccaacccccgcctcgccacggggcgggtggaggtggagctctctgccctcgaggtcctc
gccgaggccaagacgccccccttccccgtggacgcgggctggcggggggaggaggagaag
gaggcaagtgaggagctccgcctcaagtaccgctacctggacctaagaaggcggcgcatg
caggagaacctgcgcctgcgccaccgggtcatcaaggccatctgggacttcctggaccgg
gagggcttcgtccaggtggaaaccccctttctcaccaaaagcaccccggaaggggcccgg
gacttcctggtgccctaccgccacgagcccggcctcttctacgccctgccccagtccccc
cagctcttcaagcagatgctgatggtggcggggctggaccgctacttccagatcgcccgc
tgcttccgggacgaggacctccgcgccgaccgccagcccgacttcacccagctggacctg
gagatgagcttcgtggaggtggaggacgtcctggagctcaacgagcgcctcatggcccac
gtcttccgcgaggcgttgggggtggagcttcccctccccttcccccggctttcctacgag
gaggccatggagcgctacggctccgacaagcccgacctccgcttcggcctggagctcaag
gaggtgggccccctcttccgccaaagcggcttcagggtcttccaggaggcggaaagcgtg
aaggcccttgccctccccaaggccctctcccgcaaggaggtcgccgagctggaggaggtg
gccaagcgccacaaggcccagggcctcgcctgggcccgggtggaggagggggggttttcc
gggggtgtggccaagtttttagaacccgtgcgggaagctctgctccaagccacggaggcc
aggcccggggacaccctcctcttcgtggcggggccccgcaaggtggcggccacggccctg
ggggcggtgcggcttagggcggcggaccttttgggcctcaagcgggagggcttccgcttc
ctctgggtggtggactttccccttttggagtgggacgaggaggaggaggcctggacctac
atgcaccaccccttcacgagcccccaccccgaggacctgcccctcctggaaaaggacccg
gggagggtgcgggccttggcctacgacctcgtcctcaacggggtggaggtgggcgggggg
tccatccgcatccacgaccccaggctccaggcccgggtcttccggcttctcggcatcggc
gaggaggagcaaagggagaagttcgggttcttcctcgaggccctggagtacggggccccg
ccccacggggggatcgcctgggggctggaccgcctcctcgccctcatgacgggaagcccc
tccatccgcgaggtcatcgccttccccaagaacaaggaaggcaaggaccccctgaccggc
gccccgagccccgtgcccgaggagcagcttagggagctcggcctcatggtggtccggcca
tga

DBGET integrated database retrieval system