KEGG   Thermus thermophilus HB8: TTHA0753Help
Entry
TTHA0753          CDS       T00220                                 

Definition
(RefSeq) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00260  Glycine, serine and threonine metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01130  Biosynthesis of antibiotics
ttj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHA0753
Enzymes [BR:ttj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TTHA0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 3169935
NCBI-ProteinID: YP_144019
UniProt: Q5SK95
Position
complement(719697..720299)
Genome map
AA seq 200 aa AA seqDB search
MRLVDLRSDTLTRPTPAMRKAMAEAEVGDDAYGEDPTVNRLEALAAERLGFERALFLPSG
TMANQVALLLHLPKELEAEARRYRKLLGGGWRQAGVLAAAGILALEEGPKHLRRDHEMAR
ALAEGLFRLGLAVDLGAVETNMVYLEVEDPEGFLQGLRARGVLAGRVGGRVRFVTHRDLM
DEDIPLALERVQDLLHSRPR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgtggacctgaggagcgacaccctcacccgccccaccccggccatgcgcaag
gccatggcggaggcggaggtgggggacgacgcctacggcgaagaccccacggtgaaccgc
ctcgaggccctggcggcggaaaggctcgggtttgaacgggccctcttcctgccctcgggc
accatggccaaccaggtggccctcctcctccacctgcccaaggagctggaggccgaggcc
cggcgttaccgcaagctcctcggaggcgggtggcggcaggcgggggtcttggccgcggcg
gggatcctggccctagaggaaggccccaagcacctccggcgcgaccacgagatggcccgc
gccctggcggaggggctttttcgcctggggctcgccgtggacctgggggcggtggagacc
aacatggtctacctggaggtggaggaccccgagggctttctccagggtctaagggcccgg
ggggtgctcgcggggcgcgtggggggaagggtgcggttcgtgacccaccgggacctcatg
gacgaggacatcccccttgccctggagagggtccaagacctccttcactccaggcccagg
tag

DBGET integrated database retrieval system