KEGG   Thermus thermophilus HB8: TTHA0771
Entry
TTHA0771          CDS       T00220                                 
Symbol
TTHA0771
Name
(GenBank) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: AAA_5 AAA RuvB_N AAA_18 GDC-P
Other DBs
NCBI-ProteinID: BAD70594
UniProt: Q5SK77
Position
1:complement(738995..740674)
AA seq 559 aa
MVPVRLPLFGPSRAEGPMGPLPLRRKALGILYYLALEGPTRRERLADLLWGHRVALQNLR
SELTHLRSFFGKEAFRGPVLTLPPGVELDRTPGSGEAMEGLEDLSPAFADWVYGWRTRLA
PGEEGTPFPKRLEAVRPPALVILIGPPGSGQESLAQALAQKLGLPLRHGLGEGAGVFYLS
EPFPPKEVGLALKPLPGRVLVVARSSFGEDPSFLLALRTRFPAEVTVVEQVPCLSWREAV
GGPLRHLPFAEAARFYLRSGGRVEVLRELLAMGNPEALPQRVRAMVALEARHLPWEARKA
LEVLALHPGPFPEKLAWILGYGEALDELEHRGWLLYCEGRYRFSEPQFRPYLTAGFGEGE
RCRLHARLAEAWEALGDPVAAAYHRFYGEKGEALKAAQLGSWRQALAAHPGPNVPLPRSR
VRKGKKRALETEEIHLVSFQGEVAEAVLELEEPLLLHLQGEVYQELPLGLGANLEAFPFR
LRSLKGEGAVYFLPRANPGYYPWGAVLPQENLDHEFLLRPGQYLLELGTPGVVSLRLQAW
ETAPGNQEILVPLEMTESL
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggtgccggtgcggcttccccttttcggcccttctcgggcggagggccccatggggcct
ctgcccctgaggcggaaggccttggggatcctctactacctggccctggaaggccctacg
cgcagggagaggcttgcggacctcctttggggccacagggtcgccctgcaaaacctgcgg
tccgaactcacccacctccgctccttcttcggaaaggaagccttccggggccccgtgctc
accctgccccctggggtggagctggaccgaactcccgggagcggggaggccatggagggg
ctcgaggacctctcccccgcctttgccgactgggtgtacgggtggcggacccggttagcc
cccggggaagaggggacgcctttccccaagcgcctggaggcggtgcgcccccctgccctg
gtgatcctcatcggtcccccaggttcggggcaggaaagcctggcccaggcccttgcccaa
aagctcggccttcccctgcggcatggcctgggcgaaggcgccggggtcttctacctctcc
gagccctttccccccaaggaggtgggcctcgccctgaaacctcttccagggcgggttctg
gtggtggcccgttccagcttcggggaggacccttcctttctcctggccctcaggacccgc
tttcccgcagaggtgaccgtggtggagcaggtaccctgcctctcctggcgggaggcggtg
ggggggcctctacgccatctgcccttcgccgaggccgcccgcttctacctgcgaagcggc
ggccgggtggaggttttgcgggaactcctagccatgggaaaccccgaggcccttccccag
cgggtgcgggccatggtggccctcgaggcccgccacctaccctgggaagcgcgcaaggcc
ctagaggtgctggcccttcacccgggacctttccccgaaaaactggcctggatcttggga
tacggggaagcgctggacgagctggagcaccggggctggctcctctactgcgaaggcagg
taccgcttcagcgagccccagttccgcccttacttgacagcggggttcggggagggggag
cgctgccgcctgcacgcccgcttggccgaagcctgggaagccctgggagatccggtggcc
gctgcctaccaccgcttttatggagaaaaaggagaagccctcaaggccgcgcagcttgga
agctggcgccaagccctggccgcccacccaggccctaacgtccctctgccccggtcccgg
gtgcgcaaggggaagaagcgggcattggaaacagaggaaatacacctcgtctccttccag
ggcgaagtggcggaagctgtactggagctggaagagcccctcctcctccatctacagggg
gaggtgtaccaagaacttcctttggggcttggggccaacctcgaggcttttcccttccgg
cttagaagcttaaagggggaaggggctgtgtactttctcccccgcgccaacccggggtat
tatccctggggcgcggtgctcccccaggaaaacctggaccacgagtttctactccgcccg
ggacagtacctactagagctagggaccccaggggtagtctccctacgcctacaagcctgg
gagaccgctccaggaaaccaagaaatcctcgtacccctagagatgaccgagagcctctaa

DBGET integrated database retrieval system