KEGG   Thermus thermophilus HB8: TTHA0785Help
Entry
TTHA0785          CDS       T00220                                 

Definition
(RefSeq) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    TTHA0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE MFS_2
Motif
Other DBs
NCBI-GeneID: 3169177
NCBI-ProteinID: YP_144051
UniProt: Q5SMG7
Position
complement(752627..753364)
Genome map
AA seq 245 aa AA seqDB search
MGLLIGFLGGVFGGLVGLGGGTVMIPLMVGLLKLPQHRAHGTSLVAVFFTGLVGALTYGL
QGSLDPKAALFLALTAILTARFGARFAHGLSERNLKRSFGWFLIAVSFLLLLRPYLAPLG
LVRGELPQDLALLLAGAFTGFLSGMMGVGGGTIMVPAMVLLLGMPQHTAQGTSLLAMVPA
SLVGAHTHLRLGNVDQDLALGLVPGVLVGTFLGGELAHVLPEGALRLVFAAVLVWTGWRY
ARPGR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggccttctcatcggcttcctcggcggggtcttcggcggcctcgtaggcctaggcggc
ggcacggtgatgatccccttgatggtggggcttctcaagcttccccagcaccgggcccac
ggcacgagcctggtggccgtcttcttcacggggctcgtgggggccttgacctacggcctg
caaggctccttggaccccaaggccgcgcttttcctggccctcaccgccatcctcaccgcc
cgcttcggcgcccgcttcgcccacggcctctccgagagaaacctcaagcggtccttcggc
tggttcctcatcgccgtaagcttcctccttctcctcaggccctacctcgcccccctcggc
ctggtgcggggcgaactcccccaggacctcgccctcctcctcgccggggccttcaccggc
ttcctctcggggatgatgggggtgggcggggggacgatcatggtcccggccatggtcctc
ctcctgggaatgccccagcacaccgcccaggggacgagcctcctcgccatggtcccggca
agcctggtgggcgcccacacccacctgcgcctggggaacgtggaccaggacctcgcccta
ggcctcgtgcccggggtcctggtgggcaccttcctagggggggagctcgcccacgtcctc
ccggaaggcgccttgcggctcgtcttcgccgccgtgctcgtctggacggggtggcggtac
gcccgtccgggaaggtaa

DBGET integrated database retrieval system