KEGG   Thermus thermophilus HB8: TTHA0786Help
Entry
TTHA0786          CDS       T00220                                 

Definition
(RefSeq) glycerate dehydrogenase/glyoxylate reductase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00630  Glyoxylate and dicarboxylate metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TTHA0786
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     TTHA0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 3170069
NCBI-ProteinID: YP_144052
UniProt: Q5SMG6
Structure
PDB: 

Position
complement(753370..754305)
Genome map
AA seq 311 aa AA seqDB search
MRVLVTRTLPGKALDRLRERGLEVEVHRGLFLPKAELLKRVEGAVGLIPTVEDRIDAEVM
DRAKGLKVIACYSVGVDHVDLEAARERGIRVTHTPGVLTEATADLTLALLLAVARRVVEG
AAYARDGLWKAWHPELLLGLDLQGLTLGLVGMGRIGQAVAKRALAFGMRVVYHARTPKPL
PYPFLSLEELLKEADVVSLHTPLTPETHRLLNRERLFAMKRGAILLNTARGALVDTEALV
EALRGHLFGAGLDVTDPEPLPPGHPLYALPNAVITPHIGSAGRTTRERMAEVAVENLLAV
LEGREPPNPVV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcctcgtcacccgcacccttcccgggaaggccctggaccgcctgcgggaaagg
ggcctcgaggtggaggtccaccgggggctcttcctccccaaagcggaactcctcaagcgg
gtggagggggcggtgggcctcatccccacggtggaggaccgcatagacgccgaggtgatg
gaccgggccaagggccttaaggtcatcgcctgctacagcgtaggggtggaccacgtggac
ctcgaggcggccagggagaggggcatccgggtcacgcacacccccggggtcctcaccgag
gccaccgccgacctcaccctcgccctcctcctcgccgtggcgaggcgggtggtggagggg
gcggcctacgcccgggacgggctctggaaggcctggcaccccgagctccttctgggcctg
gacctccagggcttgaccctcggcctcgtgggcatggggcggatcggccaggcggtggcc
aagagggccctggccttcgggatgcgggtggtctaccacgcccgcacccccaagcccctc
ccctaccccttcctctccctggaggagctccttaaagaggcggacgtcgtctccctccac
acccccctcaccccggaaacccataggctcctcaaccgggaaaggctcttcgccatgaag
cggggcgccatcctcctcaacaccgcccggggggccctggtggacaccgaggccctggtg
gaggccttaaggggccacctcttcggggcgggcctggacgtgaccgaccccgagcccctg
cccccgggccatcccctctacgcccttcccaacgccgtcattaccccccacatcggctcg
gcggggagaacgacccgggagcgcatggcggaggtggcggtggagaacctcctcgccgtc
ctggaggggagggagccgccaaacccggtagtatag

DBGET integrated database retrieval system