KEGG   Thermus thermophilus HB8: TTHA0792
Entry
TTHA0792          CDS       T00220                                 
Symbol
TTHA0792
Name
(GenBank) conserved hypothetical protein
  KO
K06024  segregation and condensation protein B
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ttj03036]
    TTHA0792 (TTHA0792)
Chromosome and associated proteins [BR:ttj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    TTHA0792 (TTHA0792)
SSDB
Motif
Pfam: SMC_ScpB TrmB UBA
Other DBs
NCBI-ProteinID: BAD70615
UniProt: Q5SK60
Position
1:complement(758243..758776)
AA seq 177 aa
MEEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERV
AGGWRLVVHPKALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGV
LESLLERGLVRVVGEKEAPGRPKLYGTTERFLEVFGLESLEDLPPLREDGPPLLLRG
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaggaagccccgagcctcaaaaccctcctcctcgccgtcctcttcgccgcgggaagg
cccgtggccctcaaggagcttagggccctgggccaccccgaggaggccgtcctccgcgcc
ctcaaggccctggagcgggacctcgaggccggccacctgggcgtggccctggagcgggtg
gcgggggggtggcggctcgtggtccatcccaaggccttggaggcggtggagcgcgtcctt
aagccctccccgcccaggctctcccgggcggccctcgaggtcctggccctcgtggcctac
caccagcccgtgacccgggcggagcttgaggccatgcggggcaagggggtggaaggggtc
ctggaaagcctcctggagcggggccttgtccgggtggtgggggagaaggaagcccccggc
cgccccaagctttacgggaccacggagcgctttttggaggtcttcggcctggagagccta
gaagacctccccccgctcagggaggacggcccacccctcctcctccgcggctag

DBGET integrated database retrieval system