KEGG   Thermus thermophilus HB8: TTHA0799
Entry
TTHA0799          CDS       T00220                                 
Symbol
TTHA0799
Name
(GenBank) prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ttj00401  Novobiocin biosynthesis
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTHA0799 (TTHA0799)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    TTHA0799 (TTHA0799)
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     TTHA0799 (TTHA0799)
SSDB
Motif
Pfam: PDH_N PDH_C ACT ACT_6 ACT_4 SCP-1 ACT_7 SIMPL
Other DBs
NCBI-ProteinID: BAD70622
UniProt: Q5SK53
Position
1:complement(763907..764986)
AA seq 359 aa
MKPLFGKVGVFGVGLLGGSVALGIKERFLAEEVHAYDQDPMALEKVLFLGVADRVHTEVG
PWVGELDLGILAAPVGALAELGKALAPWAHPESLWTDVGSVKAKVVAALEGLLPHYLGGH
PMAGSERAGVENAHAGLLQNAVWVLTPTERTSPRAREGVRGLVEALGAYPLEMPPGRHDE
LVARVSHLPYLLAVALNRMVAQSPHRDLLMFLAAGGFRDLTRVASGSPRMSRDMVVENKE
ALKEAIEELREVLLELEGLLDEPEGLLRAAEEAKRTRDSLPIVRRSLLPEMHDLVVQVPD
RPGEIARIATALGEAGVNIKDIEVLTIREAAGALRLSFATREERERARRVLQEAGYRLP
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaagcccctcttcggcaaagtcggggtcttcggcgtgggccttctgggcgggagcgtg
gccctggggattaaggagcgcttcctcgccgaggaggtccacgcctacgatcaggaccct
atggccctggagaaggtcctctttctcggcgtggccgaccgggtgcacaccgaggtgggc
ccctgggtgggggagcttgacctggggatcctcgcggcccccgtgggggcgctggccgag
ctggggaaggccctcgccccctgggcccacccggagagcctctggaccgacgtgggaagc
gtcaaggccaaggtggtggccgccctggaaggcctcctcccccactacctgggggggcac
cccatggcgggaagcgaacgggccggggtggaaaacgcccacgccgggctcctgcaaaac
gccgtctgggtcctgacccccacggaaaggacaagccccagggcccgggagggcgtgcgg
gggctcgtggaggccctgggggcctaccccctggagatgcccccggggcgccacgacgag
ctcgtggcccgggtctcccacctcccctacctcctcgccgtggccctaaaccgcatggtg
gcgcaaagcccccaccgggacctcctcatgttcctggcggcggggggcttccgcgacctc
acccgggtggcctccggctcccccaggatgagccgggacatggtggtggagaacaaggag
gccctgaaggaggccatagaggagctccgggaggtcctcctggagctggaaggcctcctg
gacgagcccgaagggttgcttcgggcggcggaggaggccaagcgcacccgggacagcctc
cccatcgtgcgccgaagcctcctccccgagatgcacgacctcgtggtccaggtgccggac
cggcccggggagatcgccaggatcgccaccgccttgggcgaggcgggggtgaacatcaag
gacatagaggtcctcaccatccgggaggcggcgggggccctccgcctctccttcgccacc
cgggaggagcgggaaagggcccggcgcgtcctccaggaggcgggctaccgcctgccctga

DBGET integrated database retrieval system