KEGG   Thermus thermophilus HB8: TTHA0834
Entry
TTHA0834          CDS       T00220                                 
Symbol
TTHA0834
Name
(GenBank) endonuclease IV
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    TTHA0834 (TTHA0834)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0834 (TTHA0834)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     TTHA0834 (TTHA0834)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     TTHA0834 (TTHA0834)
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: BAD70657
UniProt: Q5SK18
Structure
Position
1:complement(799876..800688)
AA seq 270 aa
MPRYGFHLSIAGKKGVAGAVEEATALGLTAFQIFAKSPRSWRPRALSPAEVEAFRALREA
SGGLPAVIHASYLVNLGAEGELWEKSVASLADDLEKAALLGVEYVVVHPGSGRPERVKEG
ALKALRLAGVRSRPVLLVENTAGGGEKVGARFEELAWLVADTPLQVCLDTCHAYAAGYDV
AEDPLGVLDALDRAVGLERVPVVHLNDSVGGLGSRVDHHAHLLQGKIGEGLKRVFLDPRL
KDRVFILETPRGPEEDAWNLRVFRAWLEEA
NT seq 813 nt   +upstreamnt  +downstreamnt
atgccgcgctacgggttccacctttccatcgccgggaaaaagggcgtggccggggcggtg
gaggaagccaccgccctcggcctcaccgctttccagatcttcgccaaaagcccgcggagc
tggcgcccaagggccctctccccggccgaggtggaggccttccgcgccttaagggaggcc
tccgggggcctccccgccgtgatccacgcctcctacctggtcaacctgggggcggagggg
gagctttgggagaagagcgtggcgagcctggcggacgacctggagaaggccgccctcctc
ggggtggagtacgtggtcgtccaccccggctcgggccgccccgagcgggtcaaggaaggg
gccctcaaggccctgcgcctcgccggcgtccgctcccgccccgtcctcctcgtggagaac
accgctgggggtggggagaaggtgggggcgcggtttgaggagctcgcctggctcgtggcg
gacacccccctccaggtctgcctggacacctgccacgcctacgccgccgggtacgacgtg
gccgaggaccccttgggggtcctggacgccttggaccgggccgtgggcctggagcgggtg
cccgtggtccacctcaacgactccgtgggcggcctcggaagccgcgtggaccaccacgcc
cacctcctccagggaaagatcggggaggggctcaagcgcgtctttttggacccgaggctc
aaggaccgggtcttcatcctggaaacccccaggggaccggaggaggacgcctggaacctc
cgggtctttagggcctggctcgaggaggcctaa

DBGET integrated database retrieval system