KEGG   Thermus thermophilus HB8: TTHA0860
Entry
TTHA0860          CDS       T00220                                 
Symbol
TTHA0860
Name
(GenBank) elongation factor Ts (EF-Ts)
  KO
K02357  elongation factor Ts
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ttj03012]
    TTHA0860 (TTHA0860)
   03029 Mitochondrial biogenesis [BR:ttj03029]
    TTHA0860 (TTHA0860)
Translation factors [BR:ttj03012]
 Eukaryotic type
  Elongation factors
   TTHA0860 (TTHA0860)
 Prokaryotic type
   TTHA0860 (TTHA0860)
Mitochondrial biogenesis [BR:ttj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TTHA0860 (TTHA0860)
SSDB
Motif
Pfam: EF_TS GIP1_N Ribosomal_L12 UBA
Other DBs
NCBI-ProteinID: BAD70683
UniProt: P43895
Structure
Position
1:complement(821269..821859)
AA seq 196 aa
MSQMELIKKLREATGAGMMDVKRALEDAGWDEEKAVQLLRERGAMKAAKKADREAREGII
GHYIHHNQRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSAEEIPAEELEK
ERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVKELIQQAIAKI
GENIVVRRFCRFELGA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgagccaaatggaactcatcaagaagctacgcgaagccacgggggccgggatgatggac
gtgaagcgggccctcgaggacgccggctgggacgaggagaaggcggtccagctcctccgg
gagcggggggcgatgaaggccgccaagaaggcggaccgggaagcccgcgagggcatcatc
ggccactacatccaccacaaccagcgggtgggggtcctggtggagctcaactgcgaaacg
gacttcgtggcccggaacgagctcttccagaacctggccaaggacctcgccatgcacatc
gccatgatgaacccccgctacgtctccgccgaggagatccccgccgaggagctggaaaaa
gagcggcagatctacattcaggccgccctgaacgaggggaagccccagcagatcgccgag
aagatcgccgaaggccgcctcaagaagtacctggaggaggtggtcctgctggagcagccc
ttcgtcaaggacgacaaggtcaaggtgaaggagctcatccagcaggccatcgccaagatc
ggcgagaacatcgtggtccgacgcttctgccgctttgagctgggggcgtaa

DBGET integrated database retrieval system