KEGG   Thermus thermophilus HB8: TTHA0875Help
Entry
TTHA0875          CDS       T00220                                 

Definition
(RefSeq) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TTHA0875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ttj01007]
    TTHA0875
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ttj03016]
    TTHA0875
Enzymes [BR:ttj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     TTHA0875
Amino acid related enzymes [BR:ttj01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   TTHA0875
Transfer RNA biogenesis [BR:ttj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TTHA0875
 Prokaryotic type
    TTHA0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N GAS CENP-K Mod_r DUF1465
Motif
Other DBs
NCBI-GeneID: 3168248
NCBI-ProteinID: YP_144141
UniProt: Q5SJX7
Structure
PDB: 

Position
complement(833881..835146)
Genome map
AA seq 421 aa AA seqDB search
MVDLKRLRQEPEVFHRAIREKGVALDLEALLALDQEVQELKKRLQEVQTERNQVAKRVPK
APPEEKEALIARGRALGEEAKRLEEALREKEAQLEALLLQVPLPPWPGAPVGGEEANREI
KRVGSPPEFSFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDFM
ARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILP
YEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEASLEASDRAFQELLE
NAEEILRLLELPYRLVEVATGDMGPGKWRQVDVEVYLPSEGRYRETHSCSALLDWQARRA
NLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGRVRVPKALVPYMGKEVLEPC
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggtggacctcaagcgcctgcgccaggaacccgaggtcttccaccgggccatccgggaa
aagggggtggcgctggacctggaagccctcctcgccctggaccaggaggtccaggagctg
aaaaagcgcctccaggaggtccagaccgagcgcaaccaggtagccaagcgggtcccgaag
gcccccccggaggagaaggaggccctcatcgcccggggcagggccctgggggaggaggcg
aagcggctggaggaggccctaagggagaaggaggcgcagcttgaggccctcctcctccag
gtccccctccccccctggcccggggcgcccgtggggggggaggaggcgaaccgggagatc
aagcgggtggggagcccgccggagttttccttccctcctttggaccacgtggccctcatg
gagaaaaacggctggtgggagcccaggatcagccaggtctcgggaagccgctcctacgcc
ctcaaaggggacctcgccctttacgagctcgccctcctccgcttcgccatggacttcatg
gcgcggcggggcttcctccccatgaccctcccctcctacgcccgggagaaggccttcctc
ggcaccggccacttccccgcttaccgcgaccaggtctgggccatcgccgagaccgacctc
tacctcacgggcaccgccgaggtggtcctgaacgccctccactccggggagatcctcccc
tacgaggcccttcctttgcgctacgccggctacgcccccgccttccgctccgaggcggga
agcttcggaaaggacgtgcgggggctcatgcgggtccaccagttccacaaggtggagcag
tacgtcctcaccgaggccagcctcgaggcctccgaccgggccttccaggaactcctggaa
aacgccgaggagatcctgcggcttctagagctcccctaccgcctggtggaggtggccaca
ggggacatgggcccggggaagtggcggcaggtggacgttgaggtctatctgccctcggag
gggcggtaccgggaaacccactcctgctcggcccttctggactggcaggcccggcgggcg
aacctccgctaccgcgaccccgaaggccgggtccggtacgcctacaccctgaacaacacc
gccctcgccaccccccgcatcctggccatgctcctggaaaaccaccagctccaagacggc
cgggtgcgggtgcccaaggccctcgtcccctacatgggcaaggaggtgctggagccgtgc
ggatag

DBGET integrated database retrieval system