KEGG   Thermus thermophilus HB8: TTHA0909Help
Entry
TTHA0909          CDS       T00220                                 

Definition
(RefSeq) ornithine aminotransferase
  KO
K09251  putrescine aminotransferase [EC:2.6.1.82]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00310  Lysine degradation
ttj00330  Arginine and proline metabolism
ttj01100  Metabolic pathways
ttj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    TTHA0909
   00330 Arginine and proline metabolism
    TTHA0909
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ttj01007]
    TTHA0909
Enzymes [BR:ttj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.82  putrescine---2-oxoglutarate transaminase
     TTHA0909
Amino acid related enzymes [BR:ttj01007]
 Aminotransferase (transaminase)
  Class III
   TTHA0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 3169956
NCBI-ProteinID: YP_144175
UniProt: Q5SJU9
Position
868153..869397
Genome map
AA seq 414 aa AA seqDB search
MDLDAFTLFERHINPGLAGLLRFTGLDRVESHAEGPYVWDTQGKRYLDFLGLYGTLNLGH
RHPKVVEAVKRQLDRMPMSVRVLVSEPTARLAAKLAEITPEGLEMVFFGNSGAEAVEAAI
KLARAYTGKPGIVTTQGGFHGKTMGALSLTPKPEYQDPARPLLPGVKVVPYGDLKALEEA
IDETTAAVIVEPIQGEGGIRVPPEGYLRGVRELTREKGVLMIADEVQTGLGRTGKLFGVD
WEGVSPDLMTLAKALGGGVMPIGACVGRREVFEVFKNNPLFHSSTFGGNPLAAAAALAAI
EVTLEEDLPGRALELGRHLMEGLKVLKEEHPHLIEDVRGRGLMVGVEFADADIGALVVAE
MAERGVLTAFGLNNPKVVRLEPPLIIGKEHVDEALAVFAEALKATEKALEGLLG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggacttggacgccttcaccctctttgagcggcacatcaacccaggcctcgccgggctt
ctccgcttcaccgggctagaccgggtggagtcccacgccgaaggcccctacgtctgggac
acccagggcaagcgctacctggacttcctaggcctctacggcaccctgaacctgggccac
cgccaccccaaggtggtggaggcggtcaagcggcagcttgaccgcatgcccatgtcggtg
cgggtcctggtctcggagcccacggccaggcttgccgcaaagctcgccgagatcaccccg
gagggcctggagatggtcttcttcggcaactccggggccgaggcggtggaggccgccatc
aagctggcccgggcctacaccggcaagcccggcatcgtcaccacccaaggggggttccac
ggcaagaccatgggggcgctctccctcacccccaagcccgagtaccaggaccccgcaagg
cccctcctccccggggtcaaggtggtgccctacggggacctaaaggccctggaggaggcc
atagacgaaacgaccgccgccgtgatcgtggagcccatccagggggaagggggcatccgg
gtgccccccgaggggtacctgaggggcgtgcgggagcttacccgggaaaagggcgtcctc
atgatcgccgacgaggtgcagaccggcctcggccgcacggggaagctcttcggggtggac
tgggagggggtctccccggacctcatgaccctggccaaggccctggggggcggggtgatg
cccatcggggcctgcgtggggcggcgggaggtctttgaggtcttcaagaataaccccctc
ttccactcctccaccttcggggggaaccccctggccgcggccgccgcccttgcggccatt
gaggtcaccctggaggaggacctcccggggcgggccctggagctcggccgccacctgatg
gaggggctaaaggtcctcaaggaggagcacccccacctcattgaggacgtgcgcggccgg
gggctcatggtgggcgtggagttcgcggacgccgacatcggcgccctggtggtggcggag
atggcggagaggggcgtcctcaccgccttcggcctgaataaccccaaggtggtccgcctc
gagccccccctgatcatcggcaaggagcacgtggacgaggccctcgccgtcttcgcggag
gccctcaaggctacggaaaaggccctcgagggccttctaggttga

DBGET integrated database retrieval system