KEGG   Thermus thermophilus HB8: TTHA0939
Entry
TTHA0939          CDS       T00220                                 
Symbol
TTHA0939
Name
(GenBank) pyruvate dehydrogenase (lipoamide) (EC 1.2.4.1) E1-alpha chain
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00010  Glycolysis / Gluconeogenesis
ttj00020  Citrate cycle (TCA cycle)
ttj00620  Pyruvate metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01200  Carbon metabolism
Module
ttj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA0939 (TTHA0939)
   00020 Citrate cycle (TCA cycle)
    TTHA0939 (TTHA0939)
   00620 Pyruvate metabolism
    TTHA0939 (TTHA0939)
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     TTHA0939 (TTHA0939)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N HTH_41
Other DBs
NCBI-ProteinID: BAD70762
UniProt: Q5SJR9
Position
1:complement(886814..887854)
AA seq 346 aa
MKPKVVRYLDEGEFPLAEEEALRLYRAMRRARFFDEKALTLQRQGRLGVYAPFMGQEAAQ
VGVALALEERDWVVPSYRESAMLLAKGLPIHTLILYWRAHPAGWRFPEGVRAVNPYIPIA
TQIPQAVGLALAGRYRGEDWVVATSIGDGGTSEGDFHEGLNFAAVFGAPVVFLVQNNGYA
ISVPKSRQMKVDYVARRAEGYGMPGVVVDGNDAFAVYLEAKKAVERARKGEGPTLLEALT
YRLAPHTTSDDPSRYRSKEEEEAWRAKDPILRLRKALEGRGLWGEEAEKALLLELEEEFQ
RELALADEAPEPRPEEIVEHVYAEMGPDQRRAWEALRRGLHVEEVE
NT seq 1041 nt   +upstreamnt  +downstreamnt
gtgaagccgaaggtggtgcggtatctggatgaaggggagttccccctagcggaggaagaa
gccctgaggctctaccgggccatgcgccgggcccggttttttgacgagaaggccctcacc
ctccagcgccaggggaggcttggggtctacgcccccttcatgggccaggaggcggcccag
gtgggggtggccctggccctggaggagagggactgggtcgtcccctcctaccgggaaagc
gccatgctcctcgccaaggggcttcccatccacaccctcatcctctactggcgggcccac
cctgccggctggcgcttccccgagggggtcagggcggtgaacccctacatccccatcgcc
acccagatcccccaggcggtggggctcgccctggccgggcggtaccggggggaggactgg
gtggtggccacctccatcggggacggggggacgagcgagggggacttccacgaggggctg
aacttcgccgcggtcttcggcgcccccgtggtcttcctggtgcagaacaacggctacgcc
atcagcgtccccaaaagccgccagatgaaggtggactacgtggcgaggcgggccgagggg
tacgggatgccgggggtggtggtggacgggaacgacgccttcgccgtgtacctcgaggcc
aagaaggcggtggagagggccaggaagggggagggccccaccctcctcgaggccctcacc
taccgcctcgccccccacaccacctccgacgacccctcccgctaccgcagcaaagaggaa
gaggaagcctggcgggccaaggacccgatcctccgcctgcggaaggccctggaggggcgg
ggcctctggggcgaggaggcggagaaggcgcttcttcttgagcttgaggaggagttccag
agggagctcgccctggccgacgaagcccccgagcccaggcccgaggagatcgtggagcac
gtctacgccgagatgggccccgaccagaggcgggcctgggaggccctcaggcgaggcctc
cacgtggaggaggtggagtga

DBGET integrated database retrieval system