KEGG   Thermus thermophilus HB8: TTHA0965
Entry
TTHA0965          CDS       T00220                                 
Symbol
TTHA0965
Name
(GenBank) phenylacetic acid degradation protein PaaI
  KO
K02614  acyl-CoA thioesterase [EC:3.1.2.-]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00360  Phenylalanine metabolism
ttj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    TTHA0965 (TTHA0965)
SSDB
Motif
Pfam: 4HBT 4HBT_3 DUF4442 4HBT_2 YiiD_C
Other DBs
NCBI-ProteinID: BAD70788
UniProt: Q5SJP3
Structure
Position
1:909904..910314
AA seq 136 aa
MRDPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGP
AVALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRLGGD
GDDVPAGTGNLAPREA
NT seq 411 nt   +upstreamnt  +downstreamnt
atgagggaccccttcatggaggccttgggcctaaaggtcctccacctcgccccgggggaa
gcggtggtggcgggggaggtgcgggcggaccacttaaacctccacggcaccgcccacggg
ggcttcctctacgccctggcggacagcgccttcgccctggccagcaacacccgggggccc
gccgtggccctctcctgccgcatggactacttccgtccccttggggcgggggcgcgggtg
gaggcgagggcggtggaggtgaacctctcccggcgcacggccacctaccgggtggaggtg
gtctccgaaggcaagctcgtggccctcttcacgggaacggtctttcgcttgggaggtgat
ggggatgatgtaccagccggaactggaaaccttgccccgcgagaagcttag

DBGET integrated database retrieval system