KEGG   Thermus thermophilus HB8: TTHA1013Help
Entry
TTHA1013          CDS       T00220                                 

Definition
(RefSeq) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1902
Motif
Other DBs
NCBI-GeneID: 3169119
NCBI-ProteinID: YP_144279
UniProt: Q5SJJ5
Structure
PDB: 

Position
complement(958299..958520)
Genome map
AA seq 73 aa AA seqDB search
MRTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLEENGVALELPV
ELRLEATRPLVFS
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaccctcaaggtacaggccctgtgggatggggaagccggggtgtgggtagcggaa
agcgacgacgtccccgggcttgccacggaagccgccaccctggaggagcttctggccaag
ctcgcggtcatggtgccggagctccttgaggaaaacggggtggccctggagctcccggtg
gagcttcgcctcgaggctacccggcccctggtcttctcctga

DBGET integrated database retrieval system