KEGG   Thermus thermophilus HB8: TTHA1054
Entry
TTHA1054          CDS       T00220                                 
Symbol
TTHA1054
Name
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03030  DNA replication
ttj03410  Base excision repair
ttj03420  Nucleotide excision repair
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TTHA1054 (TTHA1054)
   03410 Base excision repair
    TTHA1054 (TTHA1054)
   03420 Nucleotide excision repair
    TTHA1054 (TTHA1054)
   03440 Homologous recombination
    TTHA1054 (TTHA1054)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttj03032]
    TTHA1054 (TTHA1054)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1054 (TTHA1054)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TTHA1054 (TTHA1054)
DNA replication proteins [BR:ttj03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     TTHA1054 (TTHA1054)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     TTHA1054 (TTHA1054)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     TTHA1054 (TTHA1054)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N Taq-exonuc 5_3_exonuc HHH_5 HHH_2
Other DBs
NCBI-ProteinID: BAD70877
UniProt: P52028
Position
1:996840..999344
AA seq 834 aa
MEAMLPLFEPKGRVLLVDGHHLAYRTFFALKGLTTSRGEPVQAVYGFAKSLLKALKEDGY
KAVFVVFDAKAPSFRHEAYEAYKAGRAPTPEDFPRQLALIKELVDLLGFTRLEVPGYEAD
DVLATLAKKAEKEGYEVRILTADRDLYQLVSDRVAVLHPEGHLITPEWLWEKYGLRPEQW
VDFRALVGDPSDNLPGVKGIGEKTALKLLKEWGSLENLLKNLDRVKPENVREKIKAHLED
LRLSLELSRVRTDLPLEVDLAQGREPDREGLRAFLERLEFGSLLHEFGLLEAPAPLEEAP
WPPPEGAFVGFVLSRPEPMWAELKALAACRDGRVHRAADPLAGLKDLKEVRGLLAKDLAV
LASREGLDLVPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEDAAHRALLSERLHRNLLK
RLEGEEKLLWLYHEVEKPLSRVLAHMEATGVRLDVAYLQALSLELAEEIRRLEEEVFRLA
GHPFNLNSRDQLERVLFDELRLPALGKTQKTGKRSTSAAVLEALREAHPIVEKILQHREL
TKLKNTYVDPLPSLVHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAF
VAEAGWALVALDYSQIELRVLAHLSGDENLIRVFQEGKDIHTQTASWMFGVPPEAVDPLM
RRAAKTVNFGVLYGMSAHRLSQELAIPYEEAVAFIERYFQSFPKVRAWIEKTLEEGRKRG
YVETLFGRRRYVPDLNARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLREMGAR
MLLQVHDELLLEAPQARAEEVAALAKEAMEKAYPLAVPLEVEVGMGEDWLSAKG
NT seq 2505 nt   +upstreamnt  +downstreamnt
atggaggcgatgcttccgctctttgaacccaaaggccgggtcctcctggtggacggccac
cacctggcctaccgcaccttcttcgccctgaagggcctcaccacgagccggggcgaaccg
gtgcaggcggtctacggcttcgccaagagcctcctcaaggccctgaaggaggacgggtac
aaggccgtcttcgtggtctttgacgccaaggccccctccttccgccacgaggcctacgag
gcctacaaggcggggagggccccgacccccgaggacttcccccggcagctcgccctcatc
aaggagctggtggacctcctggggtttacccgcctcgaggtccccggctacgaggcggac
gacgttctcgccaccctggccaagaaggcggaaaaggaggggtacgaggtgcgcatcctc
accgccgaccgcgacctctaccaactcgtctccgaccgcgtcgccgtcctccaccccgag
ggccacctcatcaccccggagtggctttgggagaagtacggcctcaggccggagcagtgg
gtggacttccgcgccctcgtgggggacccctccgacaacctccccggggtcaagggcatc
ggggagaagaccgccctcaagctcctcaaggagtggggaagcctggaaaacctcctcaag
aacctggaccgggtaaagccagaaaacgtccgggagaagatcaaggcccacctggaagac
ctcaggctctccttggagctctcccgggtgcgcaccgacctccccctggaggtggacctc
gcccaggggcgggagcccgaccgggaggggcttagggccttcctggagaggctggagttc
ggcagcctcctccacgagttcggcctcctggaggcccccgcccccctggaggaggccccc
tggcccccgccggaaggggccttcgtgggcttcgtcctctcccgccccgagcccatgtgg
gcggagcttaaagccctggccgcctgcagggacggccgggtgcaccgggcagcagacccc
ttggcggggctaaaggacctcaaggaggtccggggcctcctcgccaaggacctcgccgtc
ttggcctcgagggaggggctagacctcgtgcccggggacgaccccatgctcctcgcctac
ctcctggacccctccaacaccacccccgagggggtggcgcggcgctacgggggggagtgg
acggaggacgccgcccaccgggccctcctctcggagaggctccatcggaacctccttaag
cgcctcgagggggaggagaagctcctttggctctaccacgaggtggaaaagcccctctcc
cgggtcctggcccacatggaggccaccggggtacggctggacgtggcctaccttcaggcc
ctttccctggagcttgcggaggagatccgccgcctcgaggaggaggtcttccgcttggcg
ggccaccccttcaacctcaactcccgggaccagctggaaagggtgctctttgacgagctt
aggcttcccgccttggggaagacgcaaaagacaggcaagcgctccaccagcgccgcggtg
ctggaggccctacgggaggcccaccccatcgtggagaagatcctccagcaccgggagctc
accaagctcaagaacacctacgtggaccccctcccaagcctcgtccacccgaggacgggc
cgcctccacacccgcttcaaccagacggccacggccacggggaggcttagtagctccgac
cccaacctgcagaacatccccgtccgcacccccttgggccagaggatccgccgggccttc
gtggccgaggcgggttgggcgttggtggccctggactatagccagatagagctccgcgtc
ctcgcccacctctccggggacgaaaacctgatcagggtcttccaggaggggaaggacatc
cacacccagaccgcaagctggatgttcggcgtccccccggaggccgtggaccccctgatg
cgccgggcggccaagacggtgaacttcggcgtcctctacggcatgtccgcccataggctc
tcccaggagcttgccatcccctacgaggaggcggtggcctttatagagcgctacttccaa
agcttccccaaggtgcgggcctggatagaaaagaccctggaggaggggaggaagcggggc
tacgtggaaaccctcttcggaagaaggcgctacgtgcccgacctcaacgcccgggtgaag
agcgtcagggaggccgcggagcgcatggccttcaacatgcccgtccagggcaccgccgcc
gacctcatgaagctcgccatggtgaagctcttcccccgcctccgggagatgggggcccgc
atgctcctccaggtccacgacgagctcctcctggaggccccccaagcgcgggccgaggag
gtggcggctttggccaaggaggccatggagaaggcctatcccctcgccgtgcccctggag
gtggaggtggggatgggggaggactggctttccgccaagggttag

DBGET integrated database retrieval system