KEGG   Thermus thermophilus HB8: TTHA1060
Entry
TTHA1060          CDS       T00220                                 

Symbol
TTHA1060
Name
(GenBank) Mg2+ transporter MgtE
  KO
K06213  magnesium transporter
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ttj02000]
    TTHA1060 (TTHA1060)
Transporters [BR:ttj02000]
 Other transporters
  Pores ion channels [TC:1]
   TTHA1060 (TTHA1060)
SSDB
Motif
Pfam: MgtE CBS MgtE_N FliG_M FliG_N
Other DBs
NCBI-ProteinID: BAD70883
UniProt: Q5SMG8
Structure
PDB: 

Position
1:complement(1004900..1006252)
AA seq 450 aa
MEEKLAVSLQEALQEGDTRALREVLEEIHPQDLLALWDELKGEHRYVVLTLLPKAKAAEV
LSHLSPEEQAEYLKTLPPWRLREILEELSLDDLADALQAVRKEDPAYFQRLKDLLDPRTR
AEVEALARYEEDEAGGLMTPEYVAVREGMTVEEVLRFLRRAAPDAETIYYIYVVDEKGRL
KGVLSLRDLIVADPRTRVAEIMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLV
GIVTVDDVLDVLEAEATEDIHKLGAVDVPDLVYSEAGPVALWLARVRWLVILILTGMVTS
SILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEM
GVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPA
LVSNPLVATLSDVTGLLIYLSVARLLLEAV
NT seq 1353 nt   +upstreamnt  +downstreamnt
gtggaggaaaagttggccgtttccctccaagaagccttgcaggaaggggacacccgggcc
ctccgggaggtcttggaggagatccacccccaggacctcctcgccctctgggatgagctt
aagggggagcaccgctacgtggtcctcaccctcctccccaaggccaaggccgccgaggtc
ctctcccacctctccccggaggagcaggcggagtacctgaagaccctccccccctggcgc
ctgagggagatcctggaggagctctccttggacgacctcgccgacgcccttcaggcggtg
aggaaggaggaccccgcctacttccagcgcctcaaggacctcctggacccgaggacgcgg
gccgaggtggaggccctggccaggtacgaggaggacgaggcgggcggcctcatgaccccg
gagtacgtggccgtgcgggaggggatgaccgtggaggaggtcctccgcttcctgcgccgg
gcggcccccgacgccgagaccatctactacatctacgtggtggacgaaaagggccgcctc
aagggggtgctctccttgcgggacctcatcgtggccgaccccaggacgcgggtggcggag
atcatgaaccccaaggtggtctacgtgcgcacggacacggaccaggaggaggtggcccgc
ctcatggccgactacgacttcaccgtgctgccggtggtggacgaggagggccgcctggtg
gggatcgtcaccgtggacgacgtcctggacgtgctggaggccgaggccacggaggacatc
cacaagctcggcgccgtggacgtgcccgacctcgtctacagcgaggcgggccccgtggcc
ctgtggcttgcccgggtgaggtggctcgtgatcctgatcctcacggggatggttacgagc
tccatcctccaggggtttgagagcgtcctcgaggccgtcaccgccttggccttctacgtc
cccgtcctcctcggcaccggggggaacaccggcaaccagtcggccacccttatcatccgc
gccctcgccacccgcgacctggacctcagggactggcggcgggtcttcctcaaggagatg
ggggtgggcctcctcctcggcctcaccttgagctttctcctcgtgggcaaggtctactgg
gacggccaccccctcctcctccccgtggtgggcgtgtccttggtcctcatcgtcttcttc
gccaacctggtgggggccatgctccccttcctcctgaggcgcttgggcgtggacccggcc
ttggtgtccaaccccctcgtggccaccctctcggacgtcacgggcctcctcatctacctc
tccgtggcccgcctgcttttggaggcggtatga

DBGET integrated database retrieval system