KEGG   Thermus thermophilus HB8: TTHA1066
Entry
TTHA1066          CDS       T00220                                 
Symbol
TTHA1066
Name
(GenBank) proabable transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00030  Pentose phosphate pathway
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01200  Carbon metabolism
ttj01230  Biosynthesis of amino acids
Module
ttj_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TTHA1066 (TTHA1066)
Enzymes [BR:ttj01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     TTHA1066 (TTHA1066)
SSDB
Motif
Pfam: TAL_FSA ThiG TTc_toxin_rep
Other DBs
NCBI-ProteinID: BAD70889
UniProt: Q5SJE8
Structure
Position
1:complement(1012939..1013610)
AA seq 223 aa
MELYLDTASLEEIREIAAWGVLSGVTTNPTLVAKAFAAKGEALTEEAFAAHLRAICETVG
GPVSAEVTALEAEAMVAEGRRLAAIHPNIVVKLPTTEEGLKACKRLSAEGIKVNMTLIFS
ANQALLAARAGASYVSPFLGRVDDISWDGGELLREIVEMIQVQDLPVKVIAASIRHPRHV
TEAALLGADIATMPHAVFKQLLKHPLTDIGLKRFLEDWEKVKP
NT seq 672 nt   +upstreamnt  +downstreamnt
atggagctttacttggacaccgcgagcttggaggagatacgggagatcgccgcttggggg
gtgctctccggggtgaccaccaaccccaccttggtggccaaggccttcgccgccaagggg
gaggccctgaccgaggaggccttcgccgcccacctacgggcgatctgcgagacggtgggc
ggcccggtttcggcggaggtgacggccctcgaggccgaggccatggtggcggagggcagg
cggcttgccgccatccaccccaatatcgtggtcaagctccccaccaccgaggagggcctc
aaggcctgcaaacggctttccgccgaggggatcaaggtcaacatgaccctcatcttctcc
gccaaccaggccctcctcgccgcccgggccggggccagctacgtgagccccttcctgggg
cgggtggacgacatctcctgggacgggggggagcttcttcgggagatcgtggagatgatc
caggtccaggaccttcccgtcaaggtcatcgccgcctccatccgccacccccggcacgtc
accgaggccgcccttctgggggcggacatcgccaccatgccccacgccgttttcaagcag
ctcctaaagcaccccctcacggacatcggccttaagcgcttcttggaggattgggagaag
gttaagccatga

DBGET integrated database retrieval system