KEGG   Thermus thermophilus HB8: TTHA1097
Entry
TTHA1097          CDS       T00220                                 
Symbol
TTHA1097
Name
(GenBank) DNA ligase [NAD+]
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03030  DNA replication
ttj03410  Base excision repair
ttj03420  Nucleotide excision repair
ttj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TTHA1097 (TTHA1097)
   03410 Base excision repair
    TTHA1097 (TTHA1097)
   03420 Nucleotide excision repair
    TTHA1097 (TTHA1097)
   03430 Mismatch repair
    TTHA1097 (TTHA1097)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttj03032]
    TTHA1097 (TTHA1097)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1097 (TTHA1097)
Enzymes [BR:ttj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     TTHA1097 (TTHA1097)
DNA replication proteins [BR:ttj03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     TTHA1097 (TTHA1097)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     TTHA1097 (TTHA1097)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     TTHA1097 (TTHA1097)
   MMR (mismatch excision repair)
    DNA ligase
     TTHA1097 (TTHA1097)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TTHA1097 (TTHA1097)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT PTCB-BRCT HHH DNA_ligase_ZBD 5_3_exonuc RNA_pol_A_CTD OrfB_Zn_ribbon
Other DBs
NCBI-ProteinID: BAD70920
UniProt: P26996
Structure
Position
1:complement(1042879..1044909)
AA seq 676 aa
MTLEEARKRVNELRDLIRYHNYRYYVLADPEISDAEYDRLLRELKELEERFPELKSPDSP
TLQVGARPLEATFRPVRHPTRMYSLDNAFNLDELKAFEERIERALGRKGPFAYTVEHKVD
GLSVNLYYEEGVLVYGATRGDGEVGEEVTQNLLTIPTIPRRLKGVPERLEVRGEVYMPIE
AFLRLNEELEERGERIFKNPRNAAAGSLRQKDPRITAKRGLRATFYALGLGLEEVEREGV
ATQFALLHWLKEKGFPVEHGYARAVGAEGVEAVYQDWLKKRRALPFEADGVVVKLDELAL
WRELGYTARAPRFAIAYKFPAEEKETRLLDVVFQVGRTGRVTPVGILEPVFLEGSEVSRV
TLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGEERPIRWPETCPECGHRLL
KEGKVHRCPNPLCPAKRFEAIRHFASRKAMDIQGLGEKLIERLLEKGLVKDVADLYRLRK
EDLVGLERMGEKSAQNLLRQIEESKKRGLERLLYALGLPGVGEVLARNLAARFGNMDRLL
EASLEELLEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVEMEAKEKGGEALKGLTFV
ITGELSRPREEVKALLRRLGAKVTDSVSRKTSYLVVGENPGSKLEKARALGVPTLTEEEL
YRLLEARTGKKAEELV
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgaccctggaagaggcgaggaagcgggtaaacgagttacgggacctcatccgctaccac
aactaccgctactacgtcctggcggacccggagatctccgacgccgagtacgaccggctt
cttagggagctcaaggagcttgaggagcgcttccccgagctcaaaagcccggactccccc
acccttcaggtgggggcgaggcctttggaggccaccttccgccccgtccgccaccccacc
cgcatgtactccttggacaacgcctttaaccttgacgagctcaaggcctttgaggagcgg
atagaacgggccctggggcggaagggccccttcgcctacaccgtggagcacaaggtggac
gggctttccgtgaacctctactacgaggagggggtcctggtctacggggccacccggggg
gacggggaggtgggggaggaggtgacccagaacctcctcaccatccccaccatcccgagg
aggctcaagggggtgccggagcgcctcgaggtccggggggaggtctacatgcccatagag
gccttcctccggctcaacgaggagctggaggagcggggggagaggatcttcaaaaaccct
aggaatgcggcggcgggttccttaaggcaaaaagacccccgcatcaccgccaagcggggc
ctcagggccaccttctacgccttagggcttgggctggaggaggtggagagggaaggggtg
gcgacccagtttgccctcctccactggctcaaggaaaaaggcttccccgtggagcacggc
tacgcccgggccgtgggggcggaaggggtggaggcggtctaccaggactggctcaagaag
cggcgggcgcttccctttgaggcggacggggtggtggtgaagctggacgagcttgccctt
tggcgggagctcggctacaccgcccgcgccccccggttcgccatcgcctacaagttcccc
gccgaggagaaggagacccggcttttggacgtggtcttccaggtggggcgcaccgggcgg
gtgacccccgtggggatcctcgagcccgtcttcctagagggcagcgaggtctcccgggtc
accctgcacaacgagagctacatagaggagttggacatccgcatcggggactgggttttg
gtgcacaaggcgggcggggtcatccccgaggtcctccgggtcctcaaggagaggcgcacg
ggggaggaaaggcccattcgctggcccgagacctgccccgagtgcggccaccgcctcctc
aaggaggggaaggtccaccgctgccccaaccccttgtgccccgccaagcgctttgaggcc
atccgccacttcgcctcccgcaaggccatggacatccagggcctgggggaaaagctcatt
gagaggcttttggaaaaggggctggtcaaggacgtggccgacctctaccgcttgagaaag
gaagacctggtgggcctggagcgcatgggggagaagagcgcccaaaacctcctccgccag
atagaggagagcaagaaaagaggcctggagcgcctcctctacgccttggggcttcccggg
gtgggggaggtcttggcccggaacctggcggcccgcttcgggaacatggaccgcctcctc
gaggccagcctggaggagctcctggaggtggaggaggtgggggagctcacggcgagggcc
atcctggagaccttgaaggaccccgccttccgcgacctggtacggaggctcaaggaggcg
ggggtggagatggaggccaaggagaagggcggggaggcccttaaagggctcaccttcgtg
atcaccggggagctttcccgcccccgggaagaggtgaaggccctcctaaggcgcctcggg
gccaaggtgacggactccgtgagccggaagacgagctacctcgtggtgggggagaacccg
gggagcaagctggagaaggccagggccctcggggtccccaccctcacggaggaggagctc
taccggctcctggaggcgcggacggggaagaaggcggaggagctcgtctaa

DBGET integrated database retrieval system