KEGG   Thermus thermophilus HB8: TTHA1100
Entry
TTHA1100          CDS       T00220                                 
Symbol
TTHA1100
Name
(GenBank) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: DUF5666 MFAP1
Other DBs
NCBI-ProteinID: BAD70923
UniProt: Q5SJB4
Position
1:complement(1047749..1048678)
AA seq 309 aa
MPWLRLSLLALLGLSLVLAQEVYRPEVELVRKDKRVVAWVSGEEGSLFYADYGDLHVGEL
VALAEDRAVVGERAFFLDAGSVLEEGLSPGDRVEAAYNKDLLREGLPYLMRLRRAGEEGA
KTYLRLVLYDPKGVEVRLGEEVKARGPLALVERGGREELLLSGGEARFLEEEGRLEVRPA
PGAVALAQGATRVEGVRLRYRNDTGEAFLEGPLALSREGEKPLKGKAQALRYLLDEDALW
LLGGVEFVQGGRTTRAERALLREKEGYAYLYGGVESRDEKGFVRGERVRYALGTGEVVVL
GRVAGELRE
NT seq 930 nt   +upstreamnt  +downstreamnt
gtgccctggcttaggctctccctcctcgctctcctcggcctctccctcgtcctggcccag
gaggtctaccgcccagaggtggagctcgtccgcaaggacaagagggtggtggcctgggtg
agtggggaggaggggagcctcttctacgccgactacggggacctccacgtgggggagctc
gtggccctcgccgaggaccgggcggtggtgggggagcgggcctttttcctggacgcgggg
agcgtcctcgaggagggcctttccccgggggaccgggtggaggccgcctacaacaaggac
ctccttcgggaggggcttccctacctgatgcgcctcaggcgggcgggggaggaaggggcg
aagacctacctccgccttgtcctctacgaccccaagggggtggaggtgcgcctgggggag
gaggtgaaggcccgggggcctttggccttggtggagcggggagggagggaggagcttctt
ctctccgggggcgaggcccgttttctggaggaggaggggcgcctcgaggtccggcccgcc
ccgggggcggtggccctcgcccagggggcgacccgggtggagggggtgaggctccgctac
cgcaacgacaccggggaggcctttctggaagggcccttggccttgagccgggaaggggag
aagcccctaaagggcaaggcccaggccctccgctacctcctggacgaggacgccctctgg
cttcttgggggcgtggagttcgttcaggggggccgcaccacccgggcggagcgggccctt
ctccgggagaaggaggggtacgcctacctctacggcggcgtggagagccgggacgagaag
gggttcgtccggggcgagcgggtgcgctacgccctagggaccggggaggtggtggtcctc
ggccgggtggccggggagcttcgcgagtga

DBGET integrated database retrieval system