KEGG   Thermus thermophilus HB8: TTHA1129
Entry
TTHA1129          CDS       T00220                                 
Symbol
TTHA1129
Name
(GenBank) agmatinase (SpeB)
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00330  Arginine and proline metabolism
ttj01100  Metabolic pathways
Module
ttj_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    TTHA1129 (TTHA1129)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TTHA1129 (TTHA1129)
SSDB
Motif
Pfam: Arginase Polysacc_deac_2
Other DBs
NCBI-ProteinID: BAD70952
UniProt: Q5SJ85
Position
1:complement(1072006..1072887)
AA seq 293 aa
MRLVFGEKDTPYEEARVVVLPVPYDLSLSFLPGARRGPEAILLASRELEPFLLELGAAPE
EVGIHAAEPVPWVAGMAEESHRLIREEALRHLRAGKWVVALGGDHSVTHPLVQAHREALG
DFSLLHVDAHADLYPEWQGSVYSHASPFYRLLTEGFPLVQVGIRAMDRDSLRLARKKGVA
LFPAHRIHREGLPLDEILRALGKRVYISLDFDALDPSLMPSVGTPLPGGLSYRQVVDLLE
AVFREKEVVGMDFVELSPNGQFHAEMTAAQLVYHAIGLKGLQAGWLSREVDHI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcgcctcgtcttcggcgaaaaggacaccccttacgaggaggcgcgggtcgtcgtcctg
cccgtgccctacgacctctccctctccttcctcccgggggcccggaggggccccgaggcc
atcctcctggcgagccgcgagcttgagccctttcttttggagctcggcgccgcccccgag
gaggtggggatccacgcggccgagcccgtgccctgggtggcggggatggccgaggaaagc
caccgcctgatccgggaggaggccctaaggcacctccgggcggggaagtgggtggtggcc
ctgggcggggaccactccgtcacccaccccctggtccaggcccaccgggaggccctgggg
gatttttccctccttcacgtggacgcccacgccgacctctacccggagtggcagggctcg
gtctactcccacgcaagccccttctaccgcctcctcacggaggggtttcccctggtccag
gtggggatccgggccatggaccgagactccctgcgcttggcccgaaaaaagggcgtggcc
ctctttcccgcccaccggatccaccgggaggggcttcccctggacgagatccttagggcc
ctggggaagcgggtctacatcagcctggactttgacgccctggacccctccctcatgccc
agcgtgggcacgccccttcccggggggctttcctaccgccaggtggtggacctcctcgag
gccgtcttccgcgagaaggaggtggtggggatggacttcgtggagctctccccgaacggc
cagttccacgccgagatgaccgcggcccagctcgtctaccacgccatcggcctgaaaggg
cttcaggcgggctggctttcccgggaggtggaccacatttag

DBGET integrated database retrieval system