KEGG   Thermus thermophilus HB8: TTHA1167
Entry
TTHA1167          CDS       T00220                                 
Symbol
TTHA1167
Name
(GenBank) single-stranded DNA specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03410  Base excision repair
ttj03430  Mismatch repair
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    TTHA1167 (TTHA1167)
   03430 Mismatch repair
    TTHA1167 (TTHA1167)
   03440 Homologous recombination
    TTHA1167 (TTHA1167)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1167 (TTHA1167)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     TTHA1167 (TTHA1167)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     TTHA1167 (TTHA1167)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TTHA1167 (TTHA1167)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TTHA1167 (TTHA1167)
SSDB
Motif
Pfam: DHH RecJ_OB DHHA1 DUF2399 Rhamno_transf
Other DBs
NCBI-ProteinID: BAD70990
UniProt: Q5SJ47
Structure
Position
1:1109423..1111423
AA seq 666 aa
MRDRVRWRVLSLPPLAQWREVMAALEVGPEAALAYWHRGFRRKEDLDPPLALLPLKGLRE
AAALLEEALRQGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHRLEEGYGVLME
RVPEHLEASDLFLTVDCGITNHAELRELLENGVEVIVTDHHTPGKTPPPGLVVHPALTPD
LKEKPTGAGVAFLLLWALHERLGLPPPLEYADLAAVGTIADVAPLWGWNRALVKEGLARI
PASSWVGLRLLAEAVGYTGKAVEVAFRIAPRINAASRLGEAEKALRLLLTDDAAEAQALV
GELHRLNARRQTLEEAMLRKLLPQADPEAKAIVLLDPEGHPGVMGIVASRILEATLRPVF
LVAQGKGTVRSLAPISAVEALRSAEDLLLRYGGHKEAAGFAMDEALFPAFKARVEAYAAR
FPDPVREVALLDLLPEPGLLPQVFRELALLEPYGEGNPEPLFLLFGAPEEARRLGEGRHL
AFRLKGVRVLAWKQGDLALPPEVEVAGLLSENAWNGHLAYEVQAVDLRKPEALEGGIAPF
AYPLPLLEALARARLGEGVYVPEDNPEGLDYAWKAGFRLLPPEEAGLWLGLPPRPVLGRR
VEVALGREARARLSAPPVLHTPEARLKALVHRRLLFAYERRHPGLFSEALLAYWEVNRVQ
EPAGSP
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgagggaccgggtccgctggcgggtgctttccctccctcccctcgcccagtggcgggag
gtgatggcggccttggaggtggggccggaggccgccctggcctactggcaccggggcttt
aggcgcaaggaggacctggacccccccctcgccctccttcccctcaagggcctgagggag
gcggcggccctcctggaggaggcgctccgccaggggaagcggatccgcgtccacggggac
tacgacgccgacgggctcacgggcacggccatcctggttcggggcctcgccgccttgggc
gccgacgtccaccccttcatcccccaccggctggaggaagggtacggggtgctgatggag
cgggttcccgagcacctcgaggcctcggacctcttcctcaccgtggactgcgggatcacg
aaccacgccgagctcagggagcttttggaaaacggggtggaggtgatcgtcaccgaccac
cacacccccggcaagacccctccccccggcctcgtggtccaccccgccctcaccccggac
cttaaggagaagcccacgggggcgggggtggccttcctcctcctctgggccctccacgag
cgcctgggccttcccccacccctggagtacgccgacctcgccgcggtgggcaccatcgcc
gacgtggcccccctttggggctggaaccgggccttggtgaaggagggcctggcccgcatc
cccgcctcctcctgggttgggctcaggcttctggccgaggcggtggggtacacggggaag
gcggtggaggtggccttccgcatcgccccccggatcaacgcggcaagccgcctcggggag
gctgagaaggccctaaggctcctcctcaccgacgacgcggccgaggcccaggccctcgtg
ggggaactccaccggctgaacgcccgccgccagaccctggaggaggccatgctcaggaag
ctcctcccccaggcggaccccgaggccaaggccatcgtcctcctggaccccgaggggcac
ccgggggtgatgggcatcgtggcgagccgcatcctggaggccaccctccggcccgtcttc
ctggtggcccagggcaaggggacggtgcggagcctcgcccccatcagcgccgtggaggcc
ctaaggagcgccgaggaccttttgttgcgctacggggggcacaaggaggcggcgggcttc
gccatggacgaggccctcttccccgccttcaaggcccgggtggaggcctacgccgcccgc
ttccccgaccccgtgcgcgaggtggcccttttggacctgcttccggagcccggcctcctc
ccccaggtcttccgggagctcgcccttttggagccctacggcgagggaaaccccgagccc
ctcttcctcctcttcggcgccccggaggaggcccggcgcctcggggagggccgccacctc
gccttccgcctgaagggggtgcgggtcctggcctggaaacagggggacctcgccctgccc
ccggaggtggaggtggcgggcctcctcagcgaaaacgcctggaacggccacctcgcctac
gaggtccaggcggtggacctgcgaaagccagaggcgctggagggcgggatcgcgcccttc
gcctaccccctgcccctcctcgaggccctggcccgggcccgcctgggggaaggggtctac
gtccccgaggacaaccctgaggggctggactacgcctggaaggcgggcttccgcctcctc
ccccccgaggaggccgggctttggctcggcctccccccaaggccggtcctgggcaggcgg
gtggaggtggccctggggcgggaggcgcgggccaggctttccgccccccccgtcctccac
acccccgaggcccggctcaaagccctcgtccaccgccgcctcctcttcgcctacgagcgc
cgtcacccgggcctcttcagcgaggccctcctcgcctactgggaggtgaaccgtgtacag
gagcccgcgggaagcccatga

DBGET integrated database retrieval system