KEGG   Thermus thermophilus HB8: TTHA1189
Entry
TTHA1189          CDS       T00220                                 
Symbol
TTHA1189
Name
(GenBank) rod shape-determining protein MreC
  KO
K03570  rod shape-determining protein MreC
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ttj03036]
    TTHA1189 (TTHA1189)
Chromosome and associated proteins [BR:ttj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    TTHA1189 (TTHA1189)
SSDB
Motif
Pfam: MreC HALZ Cnn_1N bZIP_2 DivIC YabA MerR_2 NRBF2 CAF-1_p150 ADIP bZIP_1
Other DBs
NCBI-ProteinID: BAD71012
UniProt: Q5SJ25
Position
1:1135427..1136215
AA seq 262 aa
MREHLLPRFLLALLLALGLALAALTRPLAPGFALSFSPLTAFPLHLGHRLGQNLRAAWSA
LSARQDLLAENQRLKEEVARLTTENARLRLEVARLARALEVKAGQAPGVVAVAPVVAEDA
SGLYRRLVLGLGSQDGLRPGMPVTAPQGLVGLVVEVEAHRALVRTLLDPESRVGVRVGEK
PGRGVARGAPPGLLVAEFPPTVAVAPGDLLLTGATLGLFPDGIPVGRVERVERAQGGLKV
RAWARPLVDLSLLEEVVVLRPL
NT seq 789 nt   +upstreamnt  +downstreamnt
gtgagggagcacctcctcccccgcttcctcctcgccctcctcctcgccctgggcctcgcc
ctcgccgccctcacccgccccctggccccgggcttcgccctctccttctcccccctcacc
gcgtttcccctccacctcggccaccgcctgggccagaacctccgggccgcctggagcgcc
ctctccgcgcggcaggacctcctggcggagaaccaaaggctcaaggaggaggtggcccgc
cttaccacggaaaacgcccggctccggctagaggtggcccggctcgcccgggccctggag
gtgaaggcgggccaggccccaggggtggtggccgtggcccccgtggtggccgaggacgcc
tccggcctctaccgcaggctggtcctcggcctggggagccaagacggcctccgccccggg
atgcccgtgaccgccccccagggcctcgtgggcctggtggtggaggtggaggcgcaccgc
gccctggtgcgcaccctcctggatccggaaagccgggtgggggtccgggtgggggagaag
ccgggccggggcgtggcccggggcgcccccccggggcttctcgtggccgagtttcccccc
acggtggcggtggcgccgggggacctcctcctcaccggggccaccctgggcctcttcccg
gacgggatccccgtgggccgggtggaacgggtggaacgggcccaaggcggcctcaaggtg
cgggcctgggccaggcccctggtggacctctccctcctggaggaggtggtggtcctgagg
cccctctag

DBGET integrated database retrieval system