KEGG   Thermus thermophilus HB8: TTHA1199Help
Entry
TTHA1199          CDS       T00220                                 

Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00220  Arginine biosynthesis
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01130  Biosynthesis of antibiotics
ttj01230  Biosynthesis of amino acids
Module
ttj_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    TTHA1199
Enzymes [BR:ttj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     TTHA1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 3167947
NCBI-ProteinID: YP_144465
UniProt: Q5SJ15
Structure
PDB: 

Position
complement(1143166..1144071)
Genome map
AA seq 301 aa AA seqDB search
MGGEALTLPKDLLDFSGYGPKELQALLDLAEQLKRERYRGEDLKGKVLALLFEKPSLRTR
TTLEVAMVHLGGHAVYLDQKQVGIGEREPVRDVAKNLERFVEGIAARVFRHETVEALARH
AKVPVVNALSDRAHPLQALADLLTLKEVFGGLAGLEVAWVGDGNNVLNSLLEVAPLAGLK
VRVATPKGYEPDPGLLKRANAFFTHDPKEAALGAHALYTDVWTSMGQEAEREKRLRDFQG
FQVNGELLKLLRPEGVFLHCLPAHYGEETTEEAVHGPRSRVFDQAENRLHTAKAVLLTLL
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggggggagaggccctgaccctgcccaaggaccttctggacttttccggctacggcccc
aaggagcttcaggcccttctggacctggcggagcagctaaagcgggagcgctaccggggg
gaggacctcaaagggaaggtcctcgccctcctctttgagaagccctccttgcgcacccgg
acgaccctcgaggtggccatggtccacctgggggggcacgccgtttacctggaccagaag
caggtgggcatcggggagagggagcccgtgagggacgtggccaagaacctggagcgcttc
gtggaggggatcgccgcccgggtctttcgccacgagacggtggaggccctggcccgccac
gccaaggtccccgtggtgaacgccctctccgaccgcgcccaccccctccaggccctggcg
gacctcctcaccctgaaggaggtttttggggggcttgcgggcctcgaggtggcctgggtg
ggggacggaaacaacgtcctgaactcccttcttgaggtggctcccctggcgggccttaag
gtgcgggtcgcgacccccaagggctacgagcccgaccctggccttctcaagcgggcgaac
gccttcttcacccacgaccccaaggaggccgccttgggcgcccacgccctctacaccgac
gtctggaccagcatggggcaggaggcggaaagggagaagcgcctccgggacttccagggc
ttccaggtgaacggggagttgctcaagctcctccgcccggagggtgtcttcctccactgc
ctccccgcccactacggggaggagaccacggaggaggcggtccacgggccgcggagccgg
gtctttgaccaggcggaaaaccgcctccacaccgccaaggccgtgcttcttaccttgcta
aagtag

DBGET integrated database retrieval system