KEGG   Thermus thermophilus HB8: TTHA1213Help
Entry
TTHA1213          CDS       T00220                                 

Definition
(RefSeq) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00290  Valine, leucine and isoleucine biosynthesis
ttj00650  Butanoate metabolism
ttj00660  C5-Branched dibasic acid metabolism
ttj00770  Pantothenate and CoA biosynthesis
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01130  Biosynthesis of antibiotics
ttj01210  2-Oxocarboxylic acid metabolism
ttj01230  Biosynthesis of amino acids
Module
ttj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ttj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TTHA1213
   00660 C5-Branched dibasic acid metabolism
    TTHA1213
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    TTHA1213
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TTHA1213
Enzymes [BR:ttj01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     TTHA1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M PucR POR_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 3169025
NCBI-ProteinID: YP_144479
UniProt: Q5SJ01
Position
complement(1154495..1156183)
Genome map
AA seq 562 aa AA seqDB search
MKGAEALLRALEREGVEVIFGHPGGAIMPTYDALYDSPIRHILVRHEQGGVHAATAYARA
SGRVGVVMATSGPGALNLVTGLADAMMDSTPVVAITGNVPRALIGTDAFQEADVTGVTMP
ITKHNYLVQDVNEIPRVVKEAFHIAATGRPGPVLIDIPKDVQLAEFTGSFDVKLDLPGYK
PTLKGHPKQIERALDALEKAERPVLMVGGGAQHAHAELLAFAEKTGLPVITTLMGLGAFP
GNHPLWLGMPGMHGTVAANRAIHHADVILAIGLRFDDRVTGKVSRFAPHAHTIIHVDIDP
AEIGKVVRTHIPIVGDSRLVLKELLKGAKALRLAAWWRELEEWRTRYPLRYRPKPHLQSQ
EVIRAFYEATGGHAIVTTGVGQHQMFAAQFFPVTRPRSFLTSGGLGTMGVGLPFAIGAKI
ARPEELVIDFDGDGSFQMTLQELATVVKYKLDVKVVILNNGYLGMVRQWQDLFHAKRYSE
VYLADSNPDFARLAEAYGIKGVRVERKEDLMKGVEAVLNADGPVVAEFKVYQEEGVFPMI
PAGGAAEDMILEPPEEKEEVGA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagcggaggcacttttaagggcgctggagcgggaaggggtggaggtgatcttc
ggccacccgggcggggcgatcatgcccacctacgacgccctctacgacagccccatccgc
cacatcctggtgcggcacgagcagggcggggtccatgcggccaccgcctacgcccgcgcc
tcaggccgggtgggggtggtcatggccacctcgggccccggggccctgaacctggtcacg
ggcctcgcggacgccatgatggactccaccccggtggtggccatcaccgggaacgtcccc
cgggccctcatcggcaccgacgccttccaggaggcggacgtcaccggggttaccatgccc
atcaccaagcacaactacctggtccaggacgtgaacgagatcccccgggtggtgaaggag
gccttccacatcgccgccaccggccgccccggccccgtgctcattgacatccccaaggac
gtgcagcttgcggagttcacggggagctttgacgtgaagctggacctccccgggtacaag
cccaccctgaaggggcaccccaagcagattgagagggccctggacgccctggagaaggcg
gagcgccccgtcctcatggtggggggtggggcgcagcacgcccacgccgagctcctcgcc
ttcgccgagaagacggggcttcccgtgatcaccaccctcatgggcctcggggccttcccc
gggaaccaccccttgtggctcgggatgccggggatgcacggcaccgtggccgccaaccgg
gccatccaccacgcggacgtgatcctcgccatcggcctccgctttgacgaccgggtcacg
ggcaaggtctcccgcttcgccccccacgcccacaccatcatccacgtggacatagacccc
gccgagatcggcaaggtggtgcgcacccacatccccatcgtgggggactcgaggctcgtc
ctcaaggagctcctcaagggggcgaaggccttgaggcttgccgcctggtggcgggagctc
gaggagtggcgcacccgctaccccttgcgctacaggcccaagccccacctgcagagccag
gaggtgatccgggccttctacgaggccacgggaggacacgccatcgtcaccacgggggtg
gggcagcaccagatgttcgccgcccagttcttccccgtgacgaggccgaggagcttcctc
accagtgggggcctcggcaccatgggggtggggcttcccttcgccatcggggccaagatc
gcccgccctgaggagctcgtcattgactttgacggggacggctccttccagatgaccctg
caggagctggccacggtggtgaagtacaagctggacgtgaaggtcgtcatcctgaacaac
ggctacctgggcatggtgcgccagtggcaggacctcttccacgccaagcgctacagcgag
gtctacctggcggactccaaccccgacttcgcccgcctcgccgaggcctacgggatcaag
ggggtgagggtggagcggaaggaggacctcatgaagggggtggaggccgtcctgaacgcc
gacggccccgtggtggccgagttcaaggtctaccaggaggagggggtcttccccatgatc
cccgccgggggcgcggccgaggacatgatcctcgagcctcccgaggagaaggaggaggtg
ggggcgtga

DBGET integrated database retrieval system