KEGG   Thermus thermophilus HB8: TTHA1250
Entry
TTHA1250          CDS       T00220                                 
Symbol
TTHA1250
Name
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00010  Glycolysis / Gluconeogenesis
ttj00620  Pyruvate metabolism
ttj00630  Glyoxylate and dicarboxylate metabolism
ttj00640  Propanoate metabolism
ttj00680  Methane metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA1250 (TTHA1250)
   00620 Pyruvate metabolism
    TTHA1250 (TTHA1250)
   00630 Glyoxylate and dicarboxylate metabolism
    TTHA1250 (TTHA1250)
   00640 Propanoate metabolism
    TTHA1250 (TTHA1250)
  09102 Energy metabolism
   00680 Methane metabolism
    TTHA1250 (TTHA1250)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ttj01004]
    TTHA1250 (TTHA1250)
Enzymes [BR:ttj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TTHA1250 (TTHA1250)
Lipid biosynthesis proteins [BR:ttj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TTHA1250 (TTHA1250)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N CATASP
Other DBs
NCBI-ProteinID: BAD71073
UniProt: Q5SIW4
Position
1:1186235..1188118
AA seq 627 aa
MALEKLLKVQERLWAPEDLRKKANLQDYAAEYRKSLEDPEGFWGAWARRFHWEKPFEKVL
EWTLPEHRWFLGGTTNAVYNALERNVERGLRNKVALLYLAEDGREEKLTYGELLDRVRRL
ATGLRRLGVGKGDRVVIYMPLTLEGVLAMLATAYIGAIHSVVYAGLGVSALRERILDAQA
KLLIAGDVSFRRGKGVDLRSIAEEAIRDLPLKVVWFQRAYKAELAEGHYDFHELLWGNPP
EARAEMVDAEHPLFILYTSGSTGKPKGVVHVHGGYMVGTTYHLRTFFDVKDEDVFWATSD
IGWIVGHSYIVYAPLLEGITSVLREGAPDHPDPGALWQAVERYRVNVMFTAPTAVRMFMK
YGPEWPRKYDLSSLRLLAVAGEPLNPEALKWAYEHLVDGGRRGFVADNWWQTELGGPTLG
TPLVLPAKPGFAGVALPGVEAEVVDEEGRPVPPGQGGLLVLKRPFPHMMRTVWGNHERYL
RYWQEVPGGVYASGDVASKDEEGYFSVLGRADDVLNVAGHRIGTADVESALVSHPAVAEA
AVIGVPDPLKGEAIKAFVVLRLGQTPSEELKEALVQHVRRELGPIATPSEVVFLDKLPKT
RSGKILRRLLKAQALGKDPGDLSTLEE
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggcgctggaaaagctccttaaggttcaggaaaggctttgggcaccggaggacttgcgg
aagaaggcgaacctccaggactacgcggcggagtaccggaaaagcctcgaggaccctgag
ggcttctggggggcttgggcgcggcgcttccactgggaaaagccctttgagaaggtcctt
gagtggaccctcccggagcaccgctggttcctgggcggcaccaccaacgccgtctacaac
gccctggagcggaacgtggaaaggggcctaaggaacaaggtggccctcctctacctcgcc
gaggacggccgggaggaaaagctcacctacggggagcttctggaccgggtgcgccgcctg
gccacggggcttaggcgcctcggggtgggaaagggggaccgggtggtgatctacatgccc
ctcaccctggaaggggtcctcgccatgctcgccaccgcctacatcggcgccatccacagc
gtggtctacgccgggcttggggtctcggccctgagggagcgcatcctggacgcccaggcc
aagctcctcatcgccggggacgtaagcttccggcggggaaaaggggtggacctcaggagc
atcgccgaggaggccatccgggaccttcccctaaaagtggtctggttccagcgggcgtac
aaggcggagcttgccgaagggcactacgacttccacgagctcctctggggtaaccccccc
gaggcccgggcggagatggtggacgccgagcaccccctcttcatcctctacacctcgggc
tccacgggaaagcccaagggcgtggtccacgtccacggggggtacatggtgggcaccacc
taccacctgcgcaccttctttgacgtgaaggacgaggacgtcttctgggccacgagcgac
atcggctggatcgtgggccactcctacatcgtctacgcccctcttcttgaggggatcacc
tccgtcctccgggaaggggcccccgaccaccccgaccccggggccctctggcaggcggtg
gagcggtaccgggtgaacgtgatgttcaccgcccccacggcggtgcgcatgttcatgaag
tacggccccgagtggcccaggaagtacgacctcagctccttgcgccttctggccgtggcc
ggagagcccttgaaccccgaggccctgaagtgggcctacgagcacctggtggacgggggc
aggcggggcttcgtggcggacaactggtggcagacggagctcggcggccccaccctggga
acccccctcgtcctccccgccaagcccggcttcgccggggtggccctccccggggtggag
gcggaggtggtggacgaggagggcaggcccgtccccccggggcagggcggcctcctcgtc
ctcaagcggcccttcccccacatgatgcgcaccgtctgggggaaccacgagcgctacctc
cggtactggcaggaggtcccggggggcgtctacgccagcggggacgtggcgagcaaggac
gaggaggggtacttcagcgtcttgggccgggcggacgacgtgctgaacgtcgcggggcac
cgcatcggtaccgccgacgtggaaagcgccctggtctcccaccccgccgtggccgaggcc
gcggtcatcggcgtccccgaccccctgaagggggaggccatcaaggccttcgtggtcctt
aggcttgggcaaaccccctcggaggagctgaaggaggccctcgtccagcacgtgcgccgg
gagctcgggcccatcgccacgccgagcgaggtggtcttcctggacaagctccccaagacc
cgctcggggaagatcctgaggcggctcctcaaggcccaggccctgggcaaggaccccggg
gacctctccaccctcgaggagtag

DBGET integrated database retrieval system