KEGG   Thermus thermophilus HB8: TTHA1254
Entry
TTHA1254          CDS       T00220                                 
Symbol
TTHA1254
Name
(GenBank) conserved hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: DUF1999 DUF2835 DUF4157 Acetyltransf_1
Other DBs
NCBI-ProteinID: BAD71077
UniProt: Q5SIW0
Structure
Position
1:1193647..1194072
AA seq 141 aa
MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEA
TTVLVTRIEGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPL
VLAVRVLGSRGARGETRGVLE
NT seq 426 nt   +upstreamnt  +downstreamnt
atgcgcttccgccccttcaccgaggaagacctggaccggctcaaccggctagcgggaaag
aggcccgtaagcctcggcgccctccgcttcttcgcccgcacgggccactcctttctcgcc
gaggagggggaggagcccatgggcttcgccctggcccaggcggtgtggcaaggggaggcc
accacggtcctcgtcacccggattgaggggaggagcgtggaggccctaaggggcctcctc
cgggcggtggtgaagagcgcctacgacgccggggtctacgaggtggccctccacctggac
ccggagcgcaaggagctggaggaggccctgaaggcggagggcttcgccctcggccccctg
gtcctcgcggtccgggtcctgggaagccggggagcgcggggcgagacccggggcgtccta
gaatag

DBGET integrated database retrieval system