KEGG   Thermus thermophilus HB8: TTHA1323
Entry
TTHA1323          CDS       T00220                                 
Symbol
TTHA1323
Name
(GenBank) DNA mismatch repair protein MutL
  KO
K03572  DNA mismatch repair protein MutL
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    TTHA1323 (TTHA1323)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1323 (TTHA1323)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     TTHA1323 (TTHA1323)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-ProteinID: BAD71146
UniProt: Q9RA54
Position
1:complement(1260152..1261789)
AA seq 545 aa
MIRPLPPELRGLLARGEVLLTVKDAVRELLENALDAGARRVRVELWGGGLKRLVVEDDGE
GIPLEDLPLAVEPYATSKLQDLEGIRTLGFRGQALYALRQAARLRIRSRPRGQLGGGLLL
AEGERVEVRPVPAPPGTRVEVEGLFLGEGRDPKGEVRGVLELLKRYLLHHPRLALALFAE
GEARLLFPGAGLEEAARLAFGRLLAKRLLPLAYGAGGLEVQGLVSRPEVSRTRPDRLFLA
VNGRPVAFPEGLLRRVRRAYRELLPEGHYPVGVLNLFLPQEAFRLRLDARKEEVVLSEEV
EALVEEALLALFRRENLARALPEPKPLQPLSPPTASGLPRLRFLAQFRESYLLAEAGDTL
YVVDQHAAHERILYEDLLKRVAEGPKPLPRPLLVPLAPEEEALLEAGQEALAALFRWEPF
GPGRVRLLMAPAFLHPYPLLLPEVFKEALRGEGRSLKALLARLACLPAVKAGHPLGEAQG
QALLDALLACETPWACPHGRPVLLALKEEDLIRRFGRRSGARGGGEARPRPQEESFPEAP
LPREP
NT seq 1638 nt   +upstreamnt  +downstreamnt
gtgatccgccccctccctccggagcttaggggcctcctcgcccggggcgaggtgctcctt
acggtgaaggacgccgtgcgggagcttctggaaaacgccctggacgctggggccaggagg
gtgcgggtggagctttggggcggggggcttaagcggcttgtggtggaggacgacggggag
gggatccccctggaagacctccccctcgccgtggagccctacgccacgagcaagctccag
gaccttgagggcatccgcaccctgggcttccgcggccaggccctctacgccctaaggcag
gcggccaggctcaggatccgctcccggcctcgagggcagctcggcggcgggctcctcctc
gcggaaggggagcgggtggaggtgcgccccgtccccgcccccccggggacccgggtggag
gtggaggggcttttcctcggggaggggcgggaccccaagggggaggtccggggggtcttg
gagctcctaaagcgctacctcctccaccaccctcgcctcgccctggcccttttcgcggaa
ggggaggcccggctcctcttcccgggggcggggcttgaggaggcggcccgcctcgccttc
ggccgcctcctggccaagcggctccttcccctggcctacggggcggggggcctcgaggtc
cagggcctcgtctcccggccggaggtgagccgcacccggccggaccggctcttcctcgcg
gtgaacgggaggccggtggccttccccgaggggcttctccggcgggtgcgccgcgcctac
cgggagcttctgccggaggggcactaccccgtgggcgtcctgaacctcttcctcccccag
gaggcctttcgcctgcgcctggacgcgaggaaggaggaggtggtcctttctgaggaggtg
gaggccctggtggaggaggccctcctcgccctcttccggcgggagaacctggcccgggcc
ctccccgagcccaagcccctccagcccttaagcccccccacggcctcgggcctgccccgc
ctccgcttcctcgcccagttccgggagagctacctcctcgccgaggcgggggacaccctc
tacgtggtggaccagcacgccgcccacgagcgcatcctctacgaggacctcctcaagcgg
gtcgccgaggggccgaagcccctcccccggcccctcctcgtccccttggcccccgaggag
gaagcccttttggaggcggggcaggaggctttggcggcgcttttccgctgggagcccttc
ggccccgggagggtgcggctcctcatggcccccgccttcctccacccctacccccttctc
ctccccgaggtcttcaaggaggccttgcgcggggaggggagaagcctcaaggccctcctc
gcccgcctcgcctgcctccccgccgtcaaagcgggccaccccctgggagaggcccaaggc
caggccctcctggacgccctcctcgcctgcgagaccccctgggcctgcccccacggaagg
cccgtcctccttgccctcaaggaggaggacctcatccgccgcttcggacgccgctcgggg
gctcggggaggaggagaagcccgtcctcgtccgcaagaagaaagcttcccggaagcacct
ctaccccgagaaccttaa

DBGET integrated database retrieval system