KEGG   Thermus thermophilus HB8: TTHA1324
Entry
TTHA1324          CDS       T00220                                 
Symbol
TTHA1324
Name
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    TTHA1324 (TTHA1324)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1324 (TTHA1324)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     TTHA1324 (TTHA1324)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II AAA_27 AAA_29 T2SSE AAA_23 DUF4355
Other DBs
NCBI-ProteinID: BAD71147
UniProt: Q56239
Position
1:complement(1261786..1264245)
AA seq 819 aa
MGGYGGVKMEGMLKGEGPGPLPPLLQQYVELRDRYPDYLLLFQVGDFYECFGEDAERLAR
ALGLVLTHKTSKDFTTPMAGIPIRAFDAYAERLLKMGFRLAVADQVEPAEEAEGLVRREV
TQLLTPGTLTQEALLPREANYLAAIATGDGWGLAFLDVSTGEFKGTLLKSKSALYDELFR
HRPAEVLLAPELRENEAFVAEFRKRFPVMLSEAPFEPQGEGPLALRRAQGALLAYARATQ
GGALSVRPFRLYDPGAFVRLPEASLKALEVFEPLRGQDTLFGVLDETRTAPGRRLLQAWL
RHPLLERGPLEARLDRVERFVREGALREGVRRLLFRLADLERLATRLELSRASPRDLAAL
RRSLEILPELKGLLGEEVGLPDLSGLLEELRAALVEDPPLKVSEGGLIREGYDPDLDALR
RAHAEGVAYFLDLEAREKERTGIPTLKVGYNAVFGYYLEVTRPYYEKVPQEYRPVQTLKD
RQRYTLPEMKERERELYRLEALIKRREEEVFLALRERARKEAEALREAARILAELDVYAA
LAEVAVRHGYTRPRFGERLRIRAGRHPVVERRTAFVPNDLEMAHELVLVTGPNMAGKSTF
LRQTALIALLAQIGSFVPAEEAELPLFDGIYTRIGASDDLAGGKSTFMVEMEEVALVLKE
ATERSLVLLDEVGRGTSSLDGVAIATALAEALHERRCYTLFATHYFELTALALPRLKNLH
VAAKEEEGGLVFYHQVLPGPASKSYGVEVAEMAGLPKEVVERARALLSAMAARREGALEE
VLERLLALDPDRLTPLEALRFLHELKALALGLPLGSMKG
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgggggggtatggcggagttaagatggaaggcatgctcaagggcgaaggcccaggtcca
cttccccctcttctgcagcagtacgtggagctccgcgaccgctacccggactacctcctc
ctcttccaggtgggggacttctacgagtgcttcggggaggacgccgagcgcctcgcccgc
gcgcttggcctcgtcctcacccacaagaccagcaaggacttcaccacccccatggcgggg
atccccataagggcctttgacgcctacgccgaaaggcttcttaagatgggcttccgcctg
gcggtggccgaccaggtggagcctgccgaggaggcggaaggcctggtgcgtcgggaggtg
acccagctcctcaccccggggaccctcacccaggaggccctcctcccccgggaggccaac
tacctggccgccatcgccaccggggacgggtggggtctggcctttctggacgtctccacg
ggggagttcaaggggaccctcctcaagagcaaaagtgccctgtacgacgagcttttccgc
caccggcccgccgaggtccttttggccccggagctacgggagaacgaggccttcgtggcc
gagttccggaagcgctttcccgtgatgctctccgaggccccctttgagccccagggggag
ggtcctttggccctgaggcgggcccagggggcgctccttgcctacgcccgggccacccag
gggggggccttgagcgtgcgccctttccgcctctacgaccccggggccttcgtgcgccta
ccggaggcgagcctgaaggccctcgaggtctttgaacccttgcggggccaggacaccctc
tttggcgttctggacgagacgcgaaccgcccccggaagaaggctcctccaggcctggctc
cgccacccccttctggaaagggggcccttggaggcgaggcttgaccgggtggagcgcttc
gtgcgggagggggccctacgcgagggggtgaggcgcctcctcttccgcctcgccgacctg
gagcgcctggccacgaggctggagctttcccgggcaagccccagggaccttgccgcccta
aggcggagcctggagatcctccccgagcttaagggccttctgggggaggaggtggggctt
cccgacctctccggccttttggaggagcttagggcggctttggtggaggacccgcccctc
aaggtctccgagggggggctcatccgggaggggtacgacccggacctggacgccttgagg
cgggcccacgccgagggggtggcctacttcctggacctcgaggcccgggagaaggagagg
acgggcatccccaccctcaaggtggggtacaacgccgtcttcggctactacctggaggtg
acccggccctactacgagaaggtgccccaggagtaccgccccgtccagaccctcaaggac
cggcagcgctacaccctgccggagatgaaggaaagggagcgggagctctaccgcctcgag
gccctgatcaaaaggcgcgaggaggaggtcttccttgcccttagggagcgggcgaggaag
gaggcggaggccctaagggaggcggcgaggatcctcgccgagcttgacgtctacgccgcc
ctcgccgaggtggcggtgcgccacggctacacccggccccgcttcggggaaaggcttcgg
atcagggcggggcgccacccggtggtggagcgccgcaccgccttcgtccccaacgacctg
gagatggcccacgagctcgtcctcgtcaccgggcccaacatggcggggaagtccaccttc
ctccgccagaccgccctcatcgccctcctcgcccagatcgggagcttcgtgcccgccgag
gaggcggagcttcccctctttgacgggatctacacgaggatcggggcctcggacgacctc
gccggggggaagagcaccttcatggtggagatggaggaggtggccctggtgctcaaggag
gccaccgaacgtagcctcgtcctcctggacgaggtgggccggggcacgagcagcctggac
ggggtggccatcgccaccgccctcgccgaggccctgcacgagcggcggtgctacaccctc
ttcgccacccactactttgagctcaccgccctcgcccttccccggctcaagaacctgcac
gtggccgccaaggaggaggagggggggctcgtcttctaccaccaggtcctccccgggccc
gcctccaagagctacggggtggaggtggcggagatggcgggcctgcccaaggaggtggtg
gagcgggcccgcgccctcctcagcgccatggccgcgaggcgggagggcgccctggaggag
gtcttggagcgcctcctcgccttagaccccgaccgcctcacccccctcgaggccctgagg
ttcctccacgagctcaaggccttggccctgggcctccccctgggtagcatgaaggggtga

DBGET integrated database retrieval system