KEGG   Thermus thermophilus HB8: TTHA1357Help
Entry
TTHA1357          CDS       T00220                                 

Definition
(RefSeq) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2204 AbiEii NTP_transf_5
Motif
Other DBs
NCBI-GeneID: 3168598
NCBI-ProteinID: YP_144623
UniProt: Q5SIL2
Position
1297252..1297677
Genome map
AA seq 141 aa AA seqDB search
MTPDMLGFLRALHQEGARFLVIGGYALAFFGRPRFTKDLDLWVDAEEAPRVLAAIRRFFG
GDDLGLTVEDLASPGVVQLGYAPNRIDLVILETPPFDEAFVRALKHEVEGVQVYVVHPED
FKALKRAFGRPVDLRDLEELE
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaccccggacatgctgggcttcctccgggccctccaccaagagggagcccggttcttg
gtcatcggggggtacgccctggccttcttcggaaggcctcgcttcaccaaggacctggac
ctctgggtggacgcggaggaagcccccagggtcctcgccgccatccgccgcttcttcggg
ggggatgacctgggcctcaccgtggaggacctggcaagccccggcgtggtccagctgggc
tacgcccccaaccgcatagacctggtgatcctggaaacgcccccctttgacgaggccttc
gtccgggccctgaagcacgaggtggaaggggtccaagtctacgtggtccaccccgaagac
ttcaaggccctcaagcgagcctttgggcggcccgtggacctcagggacttggaggagctg
gaatga

DBGET integrated database retrieval system