KEGG   Thermus thermophilus HB8: TTHA1366
Entry
TTHA1366          CDS       T00220                                 
Symbol
TTHA1366
Name
(GenBank) putative iron-sulfur protein
  KO
K18929  L-lactate dehydrogenase complex protein LldF
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    TTHA1366 (TTHA1366)
SSDB
Motif
Pfam: LUD_dom Fer4_8 LutB_C Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_3 Fer4_7 Fer4_6 Fer4_4 Fer4_16 Fer4_21
Other DBs
NCBI-ProteinID: BAD71189
UniProt: Q5SIK3
Position
1:1303431..1304819
AA seq 462 aa
MRAKAKLYPKEAARLIREKPGVREAVTGATLHFERNRLKAYAEVPIEAWRERAKAVKDHV
LTHLDHYLELAERRLRENGVQVHWAETPEDAHRVLREVVARHGVKRAVKAKSMLTEELGV
NPLLEALGVEVYETDLGEYLIQLLGEPPSHIVGPAIHLSLEEIQRLFHQRFGTPLDAPPE
ALAQVARKVLREAFLTAELGISGANFLVAETGTLALMENEGNIRLSTSLPRVHVAFVGIE
KLLPRFADLALFLPLAARAATGQRLSTFVSLIQGPAREGEEGPLEVHVVLVDHGRTALLH
DPEAWETLRCLRCGACLNACPVYRQTGGHPYGYVYSGPIGAVLDPGLLTLEEAYPLPYAS
TLCGACLEACPVKIPIPKLLLTWRHRAVEEGLTPSWEHGAMRAFRKVMESPALYRLFSKG
LRGLPLPQDLLPLLKAWTEGRGPLKPSPKPFHELWKEVERGG
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcgggctaaggcgaagctctaccccaaggaagcggcaaggctcatccgggaaaagccc
ggggtgcgggaggcggtcaccggggccaccctccactttgaaaggaaccgcctcaaggcc
tacgccgaggtccccattgaggcgtggcgggaacgggccaaggcggtgaaggaccacgtc
ctcacccacctggaccactacctggagctcgcggaaaggcgccttcgggaaaacggcgtc
caggtgcactgggccgagaccccggaggacgcccaccgggtcttaagggaggtggtggcc
cggcacggggtgaagcgggcggtgaaggccaagagcatgctcaccgaggagctcggggtg
aaccccctcctcgaggccctgggggtggaggtctacgagacggacctcggggagtacctg
atccagcttctgggcgagcccccgagccacatcgtgggccccgccatccacctctccttg
gaggagatccagaggctcttccaccagcgcttcggcacccctttggacgccccccctgag
gccctggcccaggtggcccgcaaggtgctacgggaggccttcctcaccgccgagctcggc
atcagcggggccaacttcctggtggcggaaaccggcaccctggccctcatggagaacgag
gggaacataaggctttccacctccctccccagggtccacgtggccttcgtggggatagag
aagcttcttccccgcttcgccgacctcgccctcttcctccccctcgccgcccgggcggcc
acggggcagcgcctttccaccttcgtctccctcatccagggccccgccagggagggggag
gagggccccctggaggtccacgtggtcctggtggaccacgggcgcaccgccctcctccat
gaccccgaggcctgggagaccctgaggtgcctccgctgcggggcctgcctcaacgcctgc
cccgtctaccgccagaccggggggcacccctacggctacgtctactccggccccatcggg
gcggtcctggaccccgggctcctcaccctggaggaggcctaccccctgccctacgcctcc
accctctgcggggcctgcctggaggcctgcccggtgaagatccccatccccaagctcctc
ctcacctggcggcaccgggcggtggaggagggcctcaccccctcgtgggagcacggggcc
atgcgggccttccgcaaggtcatggaaagccccgccctctaccgcctcttctccaagggc
ttaaggggccttcccctcccccaggacctcctccccctccttaaggcctggacggagggc
aggggccccctgaagccaagccccaagcccttccacgagctctggaaggaggtggagcgt
ggaggctag

DBGET integrated database retrieval system