KEGG   Thermus thermophilus HB8: TTHA1394
Entry
TTHA1394          CDS       T00220                                 
Symbol
TTHA1394
Name
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00260  Glycine, serine and threonine metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01230  Biosynthesis of amino acids
Module
ttj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHA1394 (TTHA1394)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     TTHA1394 (TTHA1394)
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-ProteinID: BAD71217
UniProt: Q5SIH5
Position
1:1329948..1330826
AA seq 292 aa
MDLPRLYVPATLANLGSGFDALGVALDLYLEVEAHPAPEDAFLYEGEGHVEGTDNLIHEG
YRAGMRALGLEPFPLRVRAFNPIPLARGMGSSSAALVAGVALADRLSGGRLGREGVFRVA
AGLEGHPDNVAPAVYGGFVAALSDPPLAIPLPRPEGVRFVLAVPPYEVPTPLAREALPRE
VPLEDAIYNLARSALWPAALSSGRLEALREACRDRLHQPHRAHLMPGVLEAIEGALEAGA
LAAFVGGAGPTLAALARAGEEAPVIRALSAYRGPEGRTLVLGIGEGYFWKET
NT seq 879 nt   +upstreamnt  +downstreamnt
atggacctcccccgcctctacgtccccgccaccctggccaacctgggctcgggctttgac
gccttgggggtggccctggacctctacctcgaggtggaggcccaccccgccccggaggac
gccttcctctacgagggggaaggccatgtggagggtacagacaacctgatccacgagggg
taccgggccgggatgcgggccctggggctagagcccttccccttgcgggtgcgggccttc
aaccccatccccctggcccggggcatgggaagctcctccgccgccttagtggccggggtg
gccctggcggaccggctttccggggggaggcttgggcgggagggggtcttccgggtggcg
gcggggctcgagggccatcccgacaacgtggccccggcggtctacgggggcttcgtggcc
gccctgagcgacccccccttggccatccccctgccgaggcccgaaggggtgcgcttcgtc
ctggccgtccccccctacgaggtccccacccccttggcccgggaggccctgccccgggag
gtgcccctggaggacgccatctacaacctggcaagaagcgccctctggcccgcggcgctt
tcctcggggaggctcgaggccctgagggaggcctgccgcgaccggctccaccagccccac
cgggcccacctcatgcccggggtcctggaggcgatagaaggcgcgctagaggccggggcc
ctggcggccttcgtgggcggggcggggcccaccctggccgccctggcgcgcgccggggag
gaagcccccgtgatccgggccctttccgcctaccggggcccggaagggcgcacgctggta
ttgggcataggggagggatacttttggaaggagacctga

DBGET integrated database retrieval system