KEGG   Thermus thermophilus HB8: TTHA1403
Entry
TTHA1403          CDS       T00220                                 
Symbol
TTHA1403
Name
(GenBank) cytochrome c biogenesis protein, thiol:disulfide interchange protein
  KO
K02199  cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ttj03110]
    TTHA1403 (TTHA1403)
Chaperones and folding catalysts [BR:ttj03110]
 Protein folding catalysts
  Protein disulfide isomerase
   TTHA1403 (TTHA1403)
SSDB
Motif
Pfam: AhpC-TSA Redoxin Thioredoxin_8 Thioredoxin Thioredoxin_2
Other DBs
NCBI-ProteinID: BAD71226
UniProt: Q5SIG6
Position
1:complement(1335726..1336262)
AA seq 178 aa
MRGWLWLLVVLALGGLFWWGMQRNPEELPSVLAKERRPAPDFTLPLLPPYRAEWGEAFRL
ADHLGKRPIVLNFWASWCYPACYEEAPILEASWRRHREEVLFVGVNTQDKQEEALRFIAQ
FGLTFPQVYDPRGRVGVDYGMYGVPETFFIDREGRVLARHAGAIDEATLARYLEEALR
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgagggggtggctctggctcctcgtggtattggccctgggagggcttttctggtggggg
atgcagcggaaccccgaggagctcccctccgtcctggccaaggagcggaggcccgccccc
gacttcaccctccccctccttcccccctaccgggcggagtggggggaggccttccgcctc
gccgaccacctgggcaagaggcccatcgtcctcaacttctgggcgagctggtgctacccc
gcctgctacgaggaggcccccattttggaggcctcctggcgccgccaccgggaggaggtc
ctcttcgtgggggtgaacacccaggacaagcaggaggaggccctgaggtttatcgcccag
ttcggcctcaccttcccccaggtctacgatccccggggccgggtgggcgtggactacggg
atgtacggggtgcccgagaccttcttcattgaccgggagggccgggtcctcgcgcggcac
gccggggccattgacgaggccaccctggcgcgttacctggaggaggcgttgcgatga

DBGET integrated database retrieval system