KEGG   Thermus thermophilus HB8: TTHA1440
Entry
TTHA1440          CDS       T00220                                 
Symbol
TTHA1440
Name
(GenBank) excinuclease ABC subunit A (UvrA)
  KO
K03701  excinuclease ABC subunit A
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    TTHA1440 (TTHA1440)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1440 (TTHA1440)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     TTHA1440 (TTHA1440)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      TTHA1440 (TTHA1440)
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_29 AAA_21 AAA_16 AAA_22 AAA_25 AAA_23 AAA_14 AAA_18 ATPase RsgA_GTPase AAA_33 NTPase_1 NACHT DUF4350 DnaJ_CXXCXGXG APS_kinase RNA12 T2SSE ATPase_2 cobW RNA_helicase DUF2075 AAA_15
Other DBs
NCBI-ProteinID: BAD71263
UniProt: Q56242
Position
1:1366645..1369503
AA seq 952 aa
MDRIVIRGAREHNLKNISLELPRGKFIVITGVSGSGKSTLAFDTIYAEGQRRYVESLSSY
ARQFLGVMDKPEVESIEGLSPAISIDQKTTSHNPRSTVGTVTEIHDYLRLLFARVGQAFC
PECGRPIEKQSASEITDRLLKRPPGTRAILMAPLVRGRKGEYRKLFQQLLKEGYARVRVD
GVIYLLEEAQGLSLEKYEKHDIDLVIDRVVLKEEERPRIAEAVELALLRGEGLLRVLYPD
TGEEELFSEKFACPEHGSVLEELEPRIFSFNSPYGACPACSGLGYRQEFDPELVVNPELS
LAEGAILPWSRGRDTGRSYLWDRLRALAEHLGFDLKTPFKDLPEEAKRAVLYGLPEPFEV
VFRRGGKETFRVEVRYEGVIPWLEKRYQESDSEGVREALEGFMSLRPCPACGGTRYKREV
LSVKVAGRNIAEVSALPVREALAFFQGLEKTLPPFQAQIARPILREIVERLGFLVDVGLD
YLTLDRAANTLSGGEAQRIRLATQVGSGLTGVLYVLDEPSIGLHPRDNQRLIRTLKRLRD
LGNTLIVVEHDEETMRAADWIVDMGPGAGIHGGEVVAQGTLEDILKSPQSLTGAYLRGEK
RIPVPKERRKGNGKWLVLKGARAHNLKNVTLRIPLGRFVAITGPSGSGKSTLVHDVLYAA
LAQRLMRAKTTPGPYEALEGVEHLDKVIEIDQSPIGRTPRSNPATYTGVFDEIRDLFAKT
PEARKRGYGPGRFSFNVKGGRCEACGGDGTVKIEMLFLPDLYVPCEVCKGKRYNKETLEV
KLRGKSIADVLDMTVEEALDFFQNVPSIARKLQLMVDVGLGYMKLGQPSPTLSGGEAQRI
KLATELGRKATGRTLYILDEPTTGLHFDDVAKLLSVLHRLVDAGNTVVVIEHNLDVVKTA
DWVIDLGPEGGDRGGEIVAEGTPEEVALTGSPTGAFLARIPEIAARIGVAAD
NT seq 2859 nt   +upstreamnt  +downstreamnt
atggaccgcatcgtcatccggggcgctcgggagcacaacctgaagaacatcagcctggag
cttccccggggcaagttcatcgtcatcaccggggtttccggctcggggaaaagcaccttg
gcctttgacaccatctacgccgaggggcagaggcgctacgtggaaagcctctccagctac
gcccggcagtttctgggcgtgatggacaagcccgaggtggagagcattgaggggctttcc
ccggccatctccattgaccagaagaccacgagccacaacccccgctccaccgtgggcacc
gtcacggagatccacgactacctccgcctcctcttcgcccgcgtggggcaggccttctgc
cccgagtgcggccgtcccattgagaagcagtcggcgagcgagatcaccgaccgcctcctc
aagcgcccccccggcacccgggccatcctcatggcccccctggtgcggggaaggaagggg
gagtacaggaagctcttccagcagctcctgaaggaaggctacgcccgggtgcgggtggac
ggggtcatctacctcctggaggaggcccaaggcctcagcctggagaagtacgagaagcac
gacattgacctggtgattgaccgggtggtcctgaaggaggaggagcgcccccgcatcgcc
gaggcggtggagctcgccctgcttcggggggaaggccttcttcgggtcctctacccggac
accggggaagaggagctcttctcggagaagttcgcctgccccgagcacggctcggtcctg
gaggagctggagccccgcatcttctccttcaacagcccctacggggcctgccccgcctgc
tccggcctcggctaccgccaggagtttgaccccgagctcgtggtgaaccccgagctctcc
ctggccgagggggccatcctcccctggtcccgggggcgggacacggggaggagctacctc
tgggaccgccttagggccttggccgagcacctgggctttgacctcaagacccccttcaag
gacctgccggaggaggcgaagcgcgccgtcctctacggccttcccgagccctttgaggtg
gtcttccgccggggcggcaaggaaaccttccgggtggaggtgcggtacgagggggtgatc
ccctggctggagaagcgctaccaggagtccgactccgagggggtgcgggaggccctggag
ggcttcatgtccttaaggccctgccccgcctgcgggggcacccggtacaagcgggaggtc
ctctcggtgaaggtggcggggaggaacatcgccgaggtctccgccctccccgtgcgggag
gccctggcgttcttccagggcctggagaagacccttccccccttccaggcccagatcgcc
cggcccatcctcagggagatcgtggagcggctcggcttcctggtggacgtgggcctggac
tacctcaccctggaccgggcggccaacaccctctccggaggcgaggcccagaggatccgg
ctcgcgacccaggtgggctcgggcctcaccggggtcctctacgtgctggacgagcccagc
atcggcctccacccccgggacaaccagcgcctcatccgcaccctcaaaaggctccgcgac
ctgggcaacaccctcatcgtggtggaacacgacgaggagaccatgcgggccgccgactgg
atcgtggacatgggtccgggggcggggatccacgggggggaggtggtggcccagggcacc
ctggaggacatcctcaaaagcccgcaaagcctcaccggggcctacctcaggggggaaaag
aggatccccgtgcccaaggagcgccgcaaggggaacggcaagtggctcgtcctcaagggg
gcgcgggcgcacaacctgaagaacgtcaccttgaggatccccctgggccgcttcgtggcc
atcaccggcccctcgggctcggggaagagcaccctggtccacgacgtcctctacgccgcc
ctggcccaaaggctcatgcgggccaagacgacccccgggccctacgaggccctggagggg
gtggagcacctggacaaggtcattgagattgaccagtcccccatcggccgcaccccccgg
tccaaccccgccacctacaccggggtctttgacgagatccgcgacctcttcgccaagacc
ccggaggccaggaagcgggggtacggcccaggccgcttctccttcaacgtcaagggcggg
cggtgcgaggcctgcggcggggacgggacggtgaagattgagatgctcttcctccccgac
ctctacgtcccctgcgaggtctgcaagggcaagcgctacaacaaggagaccctggaggtc
aagctcagggggaagagcatcgccgacgttctggacatgacggtggaggaggccctggac
ttcttccagaacgtcccctccatcgcccggaagctccagctcatggtggacgtgggcctg
gggtacatgaagctgggccagccctcccccaccctctccgggggggaggcccagaggatc
aagctcgccacggagctcggccgcaaggccacgggccgcaccctctacatcctggacgag
cccaccacgggcctgcactttgacgacgtggcgaagctcctctcggtcctccaccggttg
gtggacgcgggcaacaccgtggtggtcattgagcacaacctggacgtggtgaagaccgcg
gactgggtgattgacctgggccccgagggcggggaccggggcggggagatcgtggccgag
ggcacccccgaggaggtggccctcacggggagccccacgggggccttcctcgcccggatc
cccgagatcgccgcccggatcggggtggcggcggactaa

DBGET integrated database retrieval system