KEGG   Thermus thermophilus HB8: TTHA1478Help
Entry
TTHA1478          CDS       T00220                                 

Definition
(RefSeq) hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PsiE
Motif
Other DBs
NCBI-GeneID: 3170141
NCBI-ProteinID: YP_144744
UniProt: Q5SI96
Position
complement(1407804..1408262)
Genome map
AA seq 152 aa AA seqDB search
MNGRNGSLTSSSSVSQDLLLQAYRRAIRLVFNLVVVALLVGLFVGTWRTFLELGLTLTEP
TVRLGLKELITNVLSLVIVLELVRAFVEYFEVERVRLEILLEIGIALALRELLLLLYEAR
LSGMDVFFWGLGILALAAGRTLAVQFSPRRAG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggcggaacgggtctttaacctcctcctctagcgtgagccaggaccttttgctc
caagcctaccggagggccatccgcctcgtgttcaacctcgtggtggtggccctcctcgtg
ggccttttcgtggggacctggcgcaccttcttggagctcggcctcaccctcacggagccc
acggtgcgcctggggctcaaggagcttatcaccaacgttctctccctggtgatcgtcttg
gagctcgtccgggccttcgtggagtactttgaggtggaacgggtgcgcctggagatcctc
ctggagatcgggatcgccctggccctgcgggagctgcttctcctcctgtatgaggcgcgg
ctttccggtatggacgtcttcttctggggcctggggatcctggccctcgcggccgggcgc
accctggcggtgcagttctccccgaggagggcaggatga

DBGET integrated database retrieval system