KEGG   Thermus thermophilus HB8: TTHA1496Help
Entry
TTHA1496          CDS       T00220                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00220  Arginine biosynthesis
ttj00330  Arginine and proline metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01130  Biosynthesis of antibiotics
ttj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TTHA1496
   00330 Arginine and proline metabolism
    TTHA1496
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TTHA1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 3169704
NCBI-ProteinID: YP_144762
UniProt: Q5SI78
Structure
PDB: 

Position
complement(1423629..1424504)
Genome map
AA seq 291 aa AA seqDB search
MERVAVVGVPMDLGANRRGVDMGPSALRYARLLEQLEDLGYTVEDLGDVPVSLARASRRR
GRGLAYLEEIRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAARGRRVGVVWVDA
HADFNTPETSPSGNVHGMPLAVLSGLGHPRLTEVFRAVDPKDVVLVGVRSLDPGEKRLLK
EAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTY
REAHLLMEILAESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRIF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcgtggccgtggtgggcgtgcccatggacctgggggcgaaccggcggggcgtg
gacatggggccgtccgccctgcggtacgcccggcttctggagcagctggaggatctgggc
tacaccgtggaggacctgggggacgtacccgtctccctggcccgggcctcgaggcgaagg
gggcggggcctcgcctacctggaggagatccgggccgcggccctcgtcctaaaggagcgc
cttgcggccctgcccgagggggttttccccatcgtcttgggcggggaccactccttgagc
atgggctccgtggcgggggccgcccggggccggcgggtgggcgtggtctgggtggacgcc
cacgccgacttcaacacccccgagacctcgccgagcggcaacgtccacggcatgcccctc
gccgtcctctcgggcctgggccatccccggctcacggaggtcttccgggccgtggacccc
aaggacgtggtcctggtgggggtgcggagcctggatcccggggagaagcgcctccttaag
gaggcgggggtccgggtctacaccatgcacgaggtggaccgcctcggcgtggcccggatc
gccgaggaggttctaaagcacctccagggcctccccctccacgtctccctggacgccgac
gtcctggaccccaccctcgcccccggggtggggaccccggtgcccggggggctcacctac
cgggaggcccacctcctcatggagatcctggccgagtcgggccgggtgcagagcctggac
ctggtggaggtgaaccccatcctggacgagcgcaaccgcaccgccgagatgctggtgggc
ctggcgctaagcctcttgggcaagcggatcttttag

DBGET integrated database retrieval system