KEGG   Thermus thermophilus HB8: TTHA1548
Entry
TTHA1548          CDS       T00220                                 
Symbol
TTHA1548
Name
(GenBank) excinuclease ABC subunit C (UvrC)
  KO
K03703  excinuclease ABC subunit C
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    TTHA1548 (TTHA1548)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1548 (TTHA1548)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     TTHA1548 (TTHA1548)
SSDB
Motif
Pfam: UvrC_RNaseH_dom UVR HHH_5 HHH_2 GIY-YIG 5_3_exonuc
Other DBs
NCBI-ProteinID: BAD71371
UniProt: Q5SI32
Position
1:1473944..1475716
AA seq 590 aa
MRAQDLPPLPETPGVYLWKRGEEVLYVGKAKSLRARVKSYFHAEGKARRIAEEATGLDFI
ATRDEVEALLLEANLIKAHRPLYNVLLKDDKHYPFLKLTNEPFPTLLVVRRVEEDGAKYY
GPFPEAGALRRIKTLIDRLFPLRKNSGYPMKRRRYPCLNYSMGRCLAPCVGKADPEAYQE
VVRQVEAVLEGRVDGLLQELEAKMREAARRLEFERAAEIRDQMEALRAFFSTDQQAFDPE
MGDLDFLGMARSGALAVVQLYQVRSGRILGRISRVVEKEEATDEEILWAFLRDHYLEASP
LPPLVLLPFPLEDLESLAELLKRRAGRKVELRVPKKGEKARLLELAERNARLALETELKL
RERRGEHPALKALQDLLGLPARPWRLEGYDISHLQGQARVFSIAVFEGGRPKRQEYRRMR
LKAGNDDYAAMEEGVFRRYTGSLKDLPLPDLLLIDGGVGQVRAAARALERAGLRLPLVGL
AKGEEVLVTPEGRELRLPLTHPALQLLIHLRDEAHQNGLRYHRKRRSEELFRVLQGIPGI
GEKRRRLLLERYGGLRALKEAPLEELARLPGMSLEAARALKAALAEEEPA
NT seq 1773 nt   +upstreamnt  +downstreamnt
gtgcgggcccaagacctccctccccttcccgagacccccggggtctacctgtggaagcgg
ggggaggaggtgctctacgtgggcaaggccaagagcctccgcgcccgggtgaaaagctac
ttccacgccgagggcaaggcgaggcgcatcgccgaggaggccacagggctagacttcatc
gccacccgggacgaggtggaggccctcctcctcgaggccaacctcatcaaggcccaccgc
cccctctacaacgtcctcctcaaggacgacaagcactaccccttcctcaagctcaccaac
gagcccttccccaccctcctcgtggtgcgccgggtggaggaggacggggccaagtactac
gggcccttccccgaggcgggggcgcttcgccgcatcaagaccctcatagaccgcctcttc
cccttgcgcaagaactcgggctaccccatgaaaaggaggcgctacccctgcctgaactac
agcatgggccgctgcctcgccccttgcgtggggaaggcggacccagaggcctaccaggag
gtggtgcgccaggtggaggcggtcctcgagggccgggtggacgggctccttcaggagctc
gaggccaagatgcgggaggcggcgagaaggcttgagtttgagcgggcggcggagatccgc
gaccagatggaggccctaagggccttcttctccacggaccagcaggcctttgacccggag
atgggggacctggactttctggggatggcccgctccggggccctcgccgtggtgcagctc
taccaggtgcgctccgggcggatcctcggccgcatcagccgcgtggtggagaaggaggag
gccacggacgaggaaatcctctgggccttcctccgggaccactacctggaggcctccccc
ctcccccccctcgtcctcctccccttccccctggaggacctggaaagcctcgccgagctc
ctcaagcgccgcgcggggcggaaggtggagcttagggtgccgaagaagggggagaaggcg
cggctcttggaactcgccgaaaggaacgcccgcctcgccttggagaccgagctcaagctc
cgggaaaggcggggggagcaccctgccctcaaggccctccaggacctcctggggcttccc
gcccgcccctggcgcctcgagggctacgacataagccacctccagggccaggcccgggtc
ttctccatcgccgtctttgaggggggaaggcccaagcggcaggagtaccgcaggatgcgc
ctcaaggcggggaacgacgactacgccgccatggaggaaggggtcttccgccgctacacg
ggaagcctcaaggaccttcccctccccgacctcctcctcattgacgggggagtgggccag
gtgcgggcggcggcaagggccctggagcgggcgggcctcaggcttcccctggtgggcctc
gccaagggggaggaggtcctggtcacgccggaagggcgggagctccgcctccccctcacc
cacccggccctgcagcttctcatccacctccgggacgaggcccaccaaaacggcctccgc
taccaccggaagcggcggagcgaggagcttttccgggtcctccagggcatccccgggatc
ggggagaaaaggaggcggctcctcttggagcgctacggggggctaagggccctcaaggag
gcccccctggaggagctcgcccggcttcccgggatgagcctcgaggccgcccgggccctc
aaggcggccctggccgaggaggagcccgcctga

DBGET integrated database retrieval system