KEGG   Thermus thermophilus HB8: TTHA1552
Entry
TTHA1552          CDS       T00220                                 
Symbol
TTHA1552
Name
(GenBank) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00230  Purine metabolism
ttj01100  Metabolic pathways
ttj01232  Nucleotide metabolism
Module
ttj_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TTHA1552 (TTHA1552)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ttj01002]
    TTHA1552 (TTHA1552)
Enzymes [BR:ttj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     TTHA1552 (TTHA1552)
Peptidases and inhibitors [BR:ttj01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   TTHA1552 (TTHA1552)
SSDB
Motif
Pfam: GATase GMP_synt_C Peptidase_C26 NAD_synthase Arginosuc_synth ATP_bind_3 tRNA_Me_trans QueC Asn_synthase PAPS_reduct HEM4
Other DBs
NCBI-ProteinID: BAD71375
UniProt: Q5SI28
Structure
Position
1:1477956..1479467
AA seq 503 aa
MVLVLDFGSQYTRLIARRLRELRAFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA
PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEV
QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF
LELAGVKRDWTPEHVLEELLREVRERAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF
VDHGLLRLGEREEVEGALRALGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS
QVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGLPEDLEFELLEPFRLLFKD
EVRELALLLGLPDTLRLRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR
RVPEIGRVVYDLTSKPPATIEWE
NT seq 1512 nt   +upstreamnt  +downstreamnt
gtggtcctggtcctggatttcggctcccagtacacgcggctcatcgcgaggaggctccgg
gagctccgggccttctccctcatccttccgggggacgcccccctggaggaggtcctcaag
caccgcccccaggccctcatcctctcgggggggccgagaagcgtctttgaccccgacgcc
ccccgacccgaccccaggctcttctcctcgggcctgcccctcctcgggatctgctacggc
atgcagctcctcgcccaggagctcgggggacgggtggagcgggcgggccgggccgagtac
ggcaaggccctcctcacccgccacgagggccccctcttccggggcctcgagggggaggtc
caggtctggatgagccaccaggacgccgtgaccgccccgcccccgggctggcgggtggtg
gcggagacggaggagaaccccgtggccgccatcgcctccccggacgggcgggcctacggc
gtccagttccaccccgaggtagcccacacccccaaggggatgcagatcctggagaacttc
ctggagcttgccggggtcaagcgggactggaccccggagcacgtcctggaagaactcctc
cgggaggtgcgggagcgggcggggaaggaccgggtcctcctcgccgtctccgggggggtg
gactcctccaccctggccctcctcctcgccaaggcgggggtggaccacctggccgtcttc
gtggaccacgggcttttgcgcctgggggagcgggaggaggtggagggggccttaagggcc
cttggggtgaacctcctggtggtggacgccaaggagcgcttcctgaaggccctaaagggc
gtggaggaccccgaggaaaagcgcaagatcatcgggcgggagttcgtggcggccttctcc
caggtggcccgggagaggggccccttccgcttcctcgcccagggaaccctctacccggac
gtcattgagtccgccggggggcacggggcggccaagatcaagagccaccacaacgtgggc
ggcctccccgaggacctggagtttgagctcctagagccctttcgcctcctcttcaaggac
gaggtgcgggagctcgccctcctcctcgggcttcccgacaccctgcgcctccgccacccc
ttccccgggcctggcctcgccgtgcgcgtcctgggggaggtgacggaggagcgcctggag
atcctgaggcgggcggacgacatcttcacgagcctcctcagggagtggggcctctacgag
aaggtggcccaagccctggcggtcctcacgcccgtgaggagcgtgggggtggcgggggac
gaaaggaagtacgggtacgtcctcgccctcagggccgtcaccaccgaggacttcatgacc
gccgactgggcgaggcttcccctggagttcctggacgaggcggcccggcggatcacccgc
agggtcccggagatcggacgggtggtctacgacctcacctccaagcccccggccacgata
gagtgggaatga

DBGET integrated database retrieval system