KEGG   Thermus thermophilus HB8: TTHA1567
Entry
TTHA1567          CDS       T00220                                 
Symbol
TTHA1567
Name
(GenBank) transcriptional regulatory protein
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj02020  Two-component system
ttj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TTHA1567 (TTHA1567)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TTHA1567 (TTHA1567)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ttj03000]
    TTHA1567 (TTHA1567)
Transcription factors [BR:ttj03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    TTHA1567 (TTHA1567)
SSDB
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp HTH_29 HTH_AsnC-type FeoC DUF6833
Other DBs
NCBI-ProteinID: BAD71390
UniProt: Q5SI13
Position
1:complement(1490633..1491256)
AA seq 207 aa
MLQGLSLEARQEALKVFRPLRLRRGAVLFAPGDPVDGVYLVRQGLVGLHRPGPGLEEGVL
DVVGPGGVFGEEALGGEARRRAGAEALTYAELYFAPREGLAALRARFAEVEAFFLQALYG
RLCSLEERLWEARHLSVAQRLARLLLRMGEDGVAPFSHQDLARMVGASRETVTKLLGEWA
LKGWVDLGYRRVEVLEPKALARLAEEL
NT seq 624 nt   +upstreamnt  +downstreamnt
atgctccaaggactgagcctcgaggcccgccaagaggccctcaaggtcttccgtcctttg
cgcttgaggcggggggcggtcctcttcgcccccggggaccccgtggacggggtctacctg
gtgcgccagggcctcgtcgggctccaccggccggggccgggcctggaggaaggggtcttg
gacgtggtggggccggggggggtctttggggaggaggccttggggggggaggcgaggcgg
cgcgccggggccgaggccctcacctacgccgagctctacttcgccccccgggagggcttg
gccgccctaagggcgcgcttcgccgaggtagaggcctttttccttcaggccctttacggg
cggctctgctccttggaggagcggctttgggaggcgcgccacctctccgtggcccagcgc
ctggcccgcctcctcctccggatgggggaggacggggtcgcccccttctcccaccaggac
ctggcccggatggtgggggcctcccgggagacggtcaccaagctcctcggggagtgggcg
ctgaaagggtgggtggacctgggctaccgcagggtggaggtcctggagcccaaggccctt
gcccgccttgccgaggaactttag

DBGET integrated database retrieval system