KEGG   Thermus thermophilus HB8: TTHA1600Help
Entry
TTHA1600          CDS       T00220                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTHA1600 (recR)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TTHA1600 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TTHA1600 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 IMS_HHH HHH_8 Prok-RING_4 HHH_3 MEIOC LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 3169139
NCBI-ProteinID: YP_144866
UniProt: Q5SHY0
Position
1522958..1523542
Genome map
AA seq 194 aa AA seqDB search
MRYPESLLKLTRALSRLPGIGPKTAQRLALHLAFHKEEAEALAEALEGIKRVRACRECGN
LAEGELCPICQDEDRDRSLLAVVESVADLYALERSGEFRGLYHVLGGALNPLEGIGPKEL
NLEGLFRRLEGVEEVVLATSMTVEGEATALYLAEELKKRGVRVTRPAYGLPVGGSLEYAD
EVTLGRALEGRRPV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacccggaaagcctcctcaagctcacccgggccctctcccgcctccccggcatc
ggccccaagacggcccagcgcctggccctccacctcgccttccacaaggaggaggccgag
gccctggcggaggccctggaggggatcaagcgggtccgggcctgccgcgagtgcggcaac
ctggccgagggggagctctgccccatctgccaggacgaggaccgggaccgctccctcctc
gccgtggtggagagcgtggccgacctgtacgccctggagcggagcggggagttccggggc
ctctaccacgtcctgggaggggccttgaaccccctggagggcatcggccccaaggagctc
aacctggagggcctcttccggcggctggaaggcgtggaggaggtggtcctcgccacctcc
atgaccgtggagggggaggccaccgccctctacctcgccgaggagctgaagaagcggggg
gtgcgggtgacccggcccgcctacggcctccccgtgggggggagcctggagtacgccgac
gaggtgaccctgggccgggccctggaggggaggcggcccgtctag

DBGET integrated database retrieval system