KEGG   Thermus thermophilus HB8: TTHA1645
Entry
TTHA1645          CDS       T00220                                 
Symbol
TTHA1645
Name
(GenBank) MutS2 protein
  KO
K07456  DNA mismatch repair protein MutS2
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    TTHA1645 (TTHA1645)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA1645 (TTHA1645)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     TTHA1645 (TTHA1645)
SSDB
Motif
Pfam: MutS_V Smr MSSS Rad17 Exonuc_VII_L
Other DBs
NCBI-ProteinID: BAD71468
UniProt: Q5SHT5
Structure
Position
1:complement(1559701..1561935)
AA seq 744 aa
MRDVLEVLEFPRVRALLAERAKTPLGRELALALAPLPREEAEKRHELTGEALSYPYALPE
AGTLREAYGRALAGARLSGPELLKAAKALEEAMALKEELLPLKNALSQVAEGIGDHTPFL
ERVRKALDEEGAVKDEASPRLAQIRRELRPLRQQILDRLYALMDRHREAFQDRFVTLRRE
RYCVPVRAGMAQKVPGILLDESESGATLFIEPFSVVKLNNRLQALRLKEEEEVNRILRDL
SERLAKDEGVPKTLEALGLLDLVQAQAALARDLGLSRPAFGERYELYRAFHPLIPDAVRN
SFALDEKNRILLISGPNMGGKTALLKTLGLAVLMAQSGLFVAAEKALLAWPDRVYADIGD
EQSLQENLSTFAGHLRRLREMLEEATSHSLVLIDELGSGTDPEEGAALSQAILEALLERG
VKGMVTTHLSPLKAFAQGREGIQNASMRFDLEALRPTYELVLGVPGRSYALAIARRLALP
EEVLKRAEALLPEGGRLEALLERLEAERLALEAERERLRRELSQVERLRKALAEREARFE
EERAERLKALEEEVRAELLKVEAELKALKEKARTEGKRDALRELMALRERYAKKAPPPPP
PPGLAPGVLVEVPSLGKRGRVVELRGEEVLVQVGPLKMSLKPQEVKPLPEAEPGKPLLAK
PRREVKEVDLRGLTVAEALLEVDQALEEARALGLSTLRLLHGKGTGALRQAIREALRRDK
RVESFADAPPGEGGHGVTVVALRP
NT seq 2235 nt   +upstreamnt  +downstreamnt
gtgcgggacgtcctcgaggtcctggagttcccccgggtccgggccctgctggcggagagg
gccaagacccccctgggccgggagcttgccctggccctcgcgccccttccccgggaagag
gcggagaagcggcacgagctcacgggggaggccctaagctacccctacgccctccccgag
gcggggaccttaagggaggcctacgggagggccctcgcgggggcgaggctttccggcccc
gagctcctaaaggcggccaaggccctggaggaggccatggccctgaaggaggagctcctt
cccctgaaaaacgccttaagccaggtggcggagggcatcggggaccacacccccttcctg
gagcgggtgaggaaggccctggacgaggagggggcggtgaaggacgaggcgagcccgagg
cttgcccagatccgaagggagcttaggcccctccgccagcagatcctggaccgcctctac
gccctcatggaccgccacagggaggccttccaggaccgcttcgtcaccttaaggcgggag
cgctactgcgtccccgtgagggcggggatggcccagaaggtgccggggatcctcctggac
gagtccgagtcgggggcgaccctcttcatagagcccttctccgtggtcaagctcaacaac
cgcctccaggccctgaggctaaaggaggaggaggaggtgaaccgcatcctccgggacctc
tccgagaggctcgccaaggacgagggggtgccgaagaccctggaggccctgggccttttg
gacctcgtccaggcccaggccgccttggcccgggacctggggctttcccgccccgctttc
ggggagcggtacgagctctaccgggcctttcaccccctgatcccggacgccgtgcggaac
tccttcgccctggacgagaaaaaccgcatcctcctcatctccggtcccaacatgggggga
aagaccgccctcctcaagaccctgggcctcgctgtcctcatggcccagtccggcctcttc
gtggcggcggagaaggcccttttggcctggcccgaccgggtctatgccgacatcggggac
gagcagtcccttcaggagaacctctccaccttcgccgggcacttaaggcgcctcagggag
atgctggaggaggccacctcccatagcctcgtcctcattgacgagctcggaagcggcacc
gaccccgaggagggggcggccctttcccaggccatcctggaggccctcctggagaggggg
gtcaaggggatggtcaccacccacctctcccccctgaaggccttcgcccagggaagggag
gggatccagaacgcctccatgcgctttgacctcgaggccctccgccccacctacgagctc
gtcctcggggtgccggggcggagctacgccttggccatcgcgaggaggctcgccctcccc
gaggaggtcctcaagcgggccgaggcccttctgcccgagggggggaggctggaggccctt
ctggagaggctcgaggccgagcgcctggccctggaggcggagcgggagcgcctgaggcgg
gagctttcccaggtggagaggctgcgcaaggccctggccgagcgggaggcccgctttgag
gaggagcgggcggaaaggctcaaggccctcgaggaggaggtgcgggccgagctcctcaag
gtggaggccgagctcaaggccctcaaggagaaggcccggaccgagggcaagcgggacgcc
ctccgggagctcatggccctccgggagcgctacgccaagaaggccccgccgcccccgcct
cccccgggcctcgcccccggggtcttggtggaggtgccctccttgggcaaacggggccgg
gtggtggagctcaggggggaggaggtcctggtccaggtgggccccctgaagatgagcctc
aagccccaggaggtgaagccccttcccgaggccgaaccgggcaagcccctcctcgccaag
ccccgacgggaggtgaaggaggtggacctccggggcctcacggtggccgaggccctcctg
gaggtggaccaggccctggaggaggcgcgggccctgggcctttccaccctccgcctcctc
cacggcaaggggacgggggccttaaggcaggccatccgggaggccctccgccgggacaag
cgggtggaaagcttcgccgacgccccgcccggcgagggggggcatggggttaccgtggtg
gcgcttcggccttga

DBGET integrated database retrieval system